27507 lines
909 KiB
Markdown
27507 lines
909 KiB
Markdown
# Console API
|
|
Console management APIs for app configuration, monitoring, and administration
|
|
|
|
## Version: 1.0
|
|
|
|
### Available authorizations
|
|
#### Bearer (HTTP, bearer)
|
|
Use the Service API key as a Bearer token in the Authorization header.
|
|
Bearer format: API_KEY
|
|
|
|
---
|
|
## console
|
|
Console management API operations
|
|
|
|
### [GET] /account/avatar
|
|
Get account avatar url
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| avatar | query | Avatar file ID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AvatarUrlResponse](#avatarurlresponse)<br> |
|
|
|
|
### [POST] /account/avatar
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AccountAvatarPayload](#accountavatarpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccountResponse](#accountresponse)<br> |
|
|
|
|
### [POST] /account/change-email
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ChangeEmailSendPayload](#changeemailsendpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultDataResponse](#simpleresultdataresponse)<br> |
|
|
|
|
### [POST] /account/change-email/check-email-unique
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [CheckEmailUniquePayload](#checkemailuniquepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /account/change-email/reset
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ChangeEmailResetPayload](#changeemailresetpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccountResponse](#accountresponse)<br> |
|
|
|
|
### [POST] /account/change-email/validity
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ChangeEmailValidityPayload](#changeemailvaliditypayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [VerificationTokenResponse](#verificationtokenresponse)<br> |
|
|
|
|
### [POST] /account/delete
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AccountDeletePayload](#accountdeletepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /account/delete/feedback
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AccountDeletionFeedbackPayload](#accountdeletionfeedbackpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /account/delete/verify
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultDataResponse](#simpleresultdataresponse)<br> |
|
|
|
|
### [GET] /account/education
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [EducationStatusResponse](#educationstatusresponse)<br> |
|
|
|
|
### [POST] /account/education
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [EducationActivatePayload](#educationactivatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Success |
|
|
|
|
### [GET] /account/education/autocomplete
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| keywords | query | | Yes | string |
|
|
| limit | query | | No | integer, <br>**Default:** 20 |
|
|
| page | query | | No | integer |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [EducationAutocompleteResponse](#educationautocompleteresponse)<br> |
|
|
|
|
### [GET] /account/education/verify
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [EducationVerifyResponse](#educationverifyresponse)<br> |
|
|
|
|
### [POST] /account/init
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AccountInitPayload](#accountinitpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /account/integrates
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccountIntegrateListResponse](#accountintegratelistresponse)<br> |
|
|
|
|
### [POST] /account/interface-language
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AccountInterfaceLanguagePayload](#accountinterfacelanguagepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccountResponse](#accountresponse)<br> |
|
|
|
|
### [POST] /account/interface-theme
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AccountInterfaceThemePayload](#accountinterfacethemepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccountResponse](#accountresponse)<br> |
|
|
|
|
### [POST] /account/name
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AccountNamePayload](#accountnamepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccountResponse](#accountresponse)<br> |
|
|
|
|
### [POST] /account/password
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AccountPasswordPayload](#accountpasswordpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccountResponse](#accountresponse)<br> |
|
|
|
|
### [GET] /account/profile
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccountResponse](#accountresponse)<br> |
|
|
|
|
### [POST] /account/timezone
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AccountTimezonePayload](#accounttimezonepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccountResponse](#accountresponse)<br> |
|
|
|
|
### [POST] /activate
|
|
Activate account with invitation token
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ActivatePayload](#activatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Account activated successfully | **application/json**: [ActivationResponse](#activationresponse)<br> |
|
|
| 400 | Already activated or invalid token | |
|
|
|
|
### [GET] /activate/check
|
|
Check if activation token is valid
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| email | query | | No | string |
|
|
| token | query | | Yes | string |
|
|
| workspace_id | query | | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ActivationCheckResponse](#activationcheckresponse)<br> |
|
|
|
|
### [GET] /agent
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| creator_ids | query | Filter by creator account IDs | No | [ string ] |
|
|
| is_created_by_me | query | Filter by creator | No | boolean |
|
|
| limit | query | Page size (1-100) | No | integer, <br>**Default:** 20 |
|
|
| mode | query | App mode filter | No | string, <br>**Available values:** "advanced-chat", "agent", "agent-chat", "all", "channel", "chat", "completion", "workflow", <br>**Default:** all |
|
|
| name | query | Filter by app name | No | string |
|
|
| page | query | Page number (1-99999) | No | integer, <br>**Default:** 1 |
|
|
| sort_by | query | Sort apps by last modified, recently created, or earliest created | No | string, <br>**Available values:** "earliest_created", "last_modified", "recently_created", <br>**Default:** last_modified |
|
|
| tag_ids | query | Filter by tag IDs | No | [ string ] |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent app list | **application/json**: [AgentAppPagination](#agentapppagination)<br> |
|
|
|
|
### [POST] /agent
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AgentAppCreatePayload](#agentappcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Agent app created successfully | **application/json**: [AgentAppDetailWithSite](#agentappdetailwithsite)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [GET] /agent/invite-options
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | query | Workflow app id for in-current-workflow markers | No | string |
|
|
| keyword | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 20 |
|
|
| page | query | | No | integer, <br>**Default:** 1 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent invite options | **application/json**: [AgentInviteOptionsResponse](#agentinviteoptionsresponse)<br> |
|
|
|
|
### [DELETE] /agent/{agent_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Agent app deleted successfully |
|
|
| 403 | Insufficient permissions |
|
|
|
|
### [GET] /agent/{agent_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent app detail | **application/json**: [AgentAppDetailWithSite](#agentappdetailwithsite)<br> |
|
|
|
|
### [PUT] /agent/{agent_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AgentAppUpdatePayload](#agentappupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent app updated successfully | **application/json**: [AgentAppDetailWithSite](#agentappdetailwithsite)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [GET] /agent/{agent_id}/api-access
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent service API access | **application/json**: [AgentApiAccessResponse](#agentapiaccessresponse)<br> |
|
|
|
|
### [POST] /agent/{agent_id}/api-enable
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AgentApiStatusPayload](#agentapistatuspayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent service API status updated | **application/json**: [AgentApiAccessResponse](#agentapiaccessresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [GET] /agent/{agent_id}/api-keys
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent service API keys | **application/json**: [ApiKeyList](#apikeylist)<br> |
|
|
|
|
### [POST] /agent/{agent_id}/api-keys
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Agent service API key created | **application/json**: [ApiKeyItem](#apikeyitem)<br> |
|
|
| 400 | Maximum keys exceeded | |
|
|
|
|
### [DELETE] /agent/{agent_id}/api-keys/{api_key_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
| api_key_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Agent service API key deleted |
|
|
|
|
### [POST] /agent/{agent_id}/audio-to-text
|
|
Transcribe audio using the current Agent debug configuration
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"draft_type"**: string, <br>**Available values:** "debug_build", "draft", <br>**Default:** draft, **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Audio transcription successful | **application/json**: [AudioTranscriptResponse](#audiotranscriptresponse)<br> |
|
|
| 400 | Bad request - Speech to text disabled or unsupported audio | |
|
|
| 404 | Agent or build draft not found | |
|
|
| 413 | Audio file too large | |
|
|
|
|
### [POST] /agent/{agent_id}/build-chat/finalize
|
|
Run a build-draft Agent App turn that asks the agent to push config updates
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
| 404 | Agent, build draft, or conversation not found | |
|
|
|
|
### [DELETE] /agent/{agent_id}/build-draft
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent build draft discarded | **application/json**: [AgentSimpleResultResponse](#agentsimpleresultresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/build-draft
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent build draft | **application/json**: [AgentBuildDraftResponse](#agentbuilddraftresponse)<br> |
|
|
| 404 | Agent build draft not found | |
|
|
|
|
### [PUT] /agent/{agent_id}/build-draft
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ComposerSavePayload](#composersavepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent build draft saved | **application/json**: [AgentBuildDraftResponse](#agentbuilddraftresponse)<br> |
|
|
|
|
### [POST] /agent/{agent_id}/build-draft/apply
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent build draft applied | **application/json**: [AgentBuildDraftApplyResponse](#agentbuilddraftapplyresponse)<br> |
|
|
|
|
### [POST] /agent/{agent_id}/build-draft/checkout
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AgentBuildDraftCheckoutPayload](#agentbuilddraftcheckoutpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent build draft checked out | **application/json**: [AgentBuildDraftResponse](#agentbuilddraftresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/chat-messages
|
|
Get Agent App chat messages for a conversation with pagination
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| conversation_id | query | Conversation ID | Yes | string |
|
|
| first_id | query | First message ID for pagination | No | string |
|
|
| limit | query | Number of messages to return (1-100) | No | integer, <br>**Default:** 20 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [MessageInfiniteScrollPaginationResponse](#messageinfinitescrollpaginationresponse)<br> |
|
|
| 404 | Agent or conversation not found | |
|
|
|
|
### [GET] /agent/{agent_id}/chat-messages/{message_id}/suggested-questions
|
|
Get suggested questions for an Agent App message
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| message_id | path | Message ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Suggested questions retrieved successfully | **application/json**: [SuggestedQuestionsResponse](#suggestedquestionsresponse)<br> |
|
|
| 404 | Agent, message, or conversation not found | |
|
|
|
|
### [POST] /agent/{agent_id}/chat-messages/{task_id}/stop
|
|
Stop a running Agent App chat message generation
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| task_id | path | Task ID to stop | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Task stopped successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/composer
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent app composer state | **application/json**: [AgentAppComposerResponse](#agentappcomposerresponse)<br> |
|
|
|
|
### [PUT] /agent/{agent_id}/composer
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ComposerSavePayload](#composersavepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent app composer saved | **application/json**: [AgentAppComposerResponse](#agentappcomposerresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/composer/candidates
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent app composer candidates | **application/json**: [AgentComposerCandidatesResponse](#agentcomposercandidatesresponse)<br> |
|
|
|
|
### [POST] /agent/{agent_id}/composer/validate
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ComposerSavePayload](#composersavepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent app composer validation result | **application/json**: [AgentComposerValidateResponse](#agentcomposervalidateresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/config/files
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config files | **application/json**: [AgentConfigFileListResponse](#agentconfigfilelistresponse)<br> |
|
|
|
|
### [POST] /agent/{agent_id}/config/files
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AgentConfigFileUploadPayload](#agentconfigfileuploadpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Uploaded config file | **application/json**: [AgentConfigFileUploadResponse](#agentconfigfileuploadresponse)<br> |
|
|
|
|
### [DELETE] /agent/{agent_id}/config/files/{name}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| name | path | Config file name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config file deleted | **application/json**: [AgentConfigDeleteResponse](#agentconfigdeleteresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/config/files/{name}/download
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| name | path | Config file name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config file download URL | **application/json**: [AgentConfigDownloadResponse](#agentconfigdownloadresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/config/files/{name}/preview
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| name | path | Config file name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Preview | **application/json**: [AgentConfigFilePreviewResponse](#agentconfigfilepreviewresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/config/manifest
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent config manifest | **application/json**: [AgentConfigManifestResponse](#agentconfigmanifestresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/config/skills
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config skills | **application/json**: [AgentConfigSkillListResponse](#agentconfigskilllistresponse)<br> |
|
|
|
|
### [POST] /agent/{agent_id}/config/skills/upload
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Uploaded config skill | **application/json**: [AgentConfigSkillUploadResponse](#agentconfigskilluploadresponse)<br> |
|
|
|
|
### [DELETE] /agent/{agent_id}/config/skills/{name}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| name | path | Config skill name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config skill deleted | **application/json**: [AgentConfigDeleteResponse](#agentconfigdeleteresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/config/skills/{name}/download
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| name | path | Config skill name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config skill download URL | **application/json**: [AgentConfigDownloadResponse](#agentconfigdownloadresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/config/skills/{name}/files/content
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
| name | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Success |
|
|
|
|
### [GET] /agent/{agent_id}/config/skills/{name}/files/download
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| name | path | Config skill name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| path | query | Normalized zip member path inside the skill package | Yes | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config skill file download URL | **application/json**: [AgentConfigDownloadResponse](#agentconfigdownloadresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/config/skills/{name}/files/preview
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| name | path | Config skill name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| path | query | Normalized zip member path inside the skill package | Yes | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config skill file preview | **application/json**: [AgentConfigSkillFilePreviewResponse](#agentconfigskillfilepreviewresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/config/skills/{name}/inspect
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| name | path | Config skill name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config skill inspect view | **application/json**: [AgentConfigSkillInspectResponse](#agentconfigskillinspectresponse)<br> |
|
|
|
|
### [POST] /agent/{agent_id}/copy
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AgentAppCopyPayload](#agentappcopypayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Agent app copied successfully | **application/json**: [AgentAppDetailWithSite](#agentappdetailwithsite)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [POST] /agent/{agent_id}/debug-conversation/refresh
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| No | **application/json**: [AgentDebugConversationRefreshPayload](#agentdebugconversationrefreshpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent debug conversation refreshed | **application/json**: [AgentDebugConversationRefreshResponse](#agentdebugconversationrefreshresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [GET] /agent/{agent_id}/drive/files
|
|
List agent drive entries for an Agent App
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| prefix | query | Key prefix filter: '<slug>/' for one skill, 'files/' for files | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Drive entries | **application/json**: [AgentDriveListResponse](#agentdrivelistresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/drive/files/download
|
|
Time-limited external signed URL for one Agent App drive value
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| key | query | Drive key, e.g. tender-analyzer/SKILL.md | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Signed URL | **application/json**: [AgentDriveDownloadResponse](#agentdrivedownloadresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/drive/files/preview
|
|
Truncated text preview of one Agent App drive value
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| key | query | Drive key, e.g. tender-analyzer/SKILL.md | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Preview | **application/json**: [AgentDrivePreviewResponse](#agentdrivepreviewresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/drive/skills
|
|
List drive-backed skills for an Agent App
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Drive skills | **application/json**: [AgentDriveSkillListResponse](#agentdriveskilllistresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/drive/skills/{skill_path}/inspect
|
|
Inspect one drive-backed skill for slash-menu hover/detail UI
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| skill_path | path | Skill path/slug, e.g. tender-analyzer | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Drive skill inspect view | **application/json**: [AgentDriveSkillInspectResponse](#agentdriveskillinspectresponse)<br> |
|
|
|
|
### [POST] /agent/{agent_id}/features
|
|
Update an Agent App's presentation features (opener, follow-up, citations, ...)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AgentAppFeaturesPayload](#agentappfeaturespayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Features updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 400 | Invalid configuration | |
|
|
| 404 | Agent not found | |
|
|
|
|
### [POST] /agent/{agent_id}/feedbacks
|
|
Create or update Agent App message feedback
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MessageFeedbackPayload](#messagefeedbackpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Feedback updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 404 | Agent or message not found | |
|
|
|
|
### [DELETE] /agent/{agent_id}/files
|
|
Delete one Agent App drive file by key
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| key | query | Drive key, e.g. files/sample.pdf | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | File removed | **application/json**: [AgentDriveDeleteResponse](#agentdrivedeleteresponse)<br> |
|
|
|
|
### [POST] /agent/{agent_id}/files
|
|
Commit an uploaded file into the Agent App drive under files/<name>
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AgentDriveFilePayload](#agentdrivefilepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | File committed into the agent drive | **application/json**: [AgentDriveFileCommitResponse](#agentdrivefilecommitresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/log-sources
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent log sources | **application/json**: [AgentLogSourceListResponse](#agentlogsourcelistresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/logs
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| end | query | End date (YYYY-MM-DD HH:MM) | No | string |
|
|
| keyword | query | Search query, answer, or conversation name | No | string |
|
|
| limit | query | Page size | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number | No | integer, <br>**Default:** 1 |
|
|
| sort_by | query | Sort by created_at or updated_at | No | string, <br>**Default:** updated_at |
|
|
| sort_order | query | Sort order: asc or desc | No | string, <br>**Default:** desc |
|
|
| source | query | Deprecated single source filter | No | string |
|
|
| sources | query | Filter by one or more source IDs, e.g. webapp:<app_id> or workflow:<app_id>. Exact workflow:<app_id>:<workflow_id>:<version>:<node_id> IDs remain supported. | No | [ string ] |
|
|
| start | query | Start date (YYYY-MM-DD HH:MM) | No | string |
|
|
| status | query | Deprecated single status filter | No | string |
|
|
| statuses | query | Filter by one or more of success, failed, paused | No | [ string ] |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent logs | **application/json**: [AgentLogListResponse](#agentloglistresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/logs/{conversation_id}/messages
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| end | query | End date (YYYY-MM-DD HH:MM) | No | string |
|
|
| keyword | query | Search query, answer, or conversation name | No | string |
|
|
| limit | query | Page size | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number | No | integer, <br>**Default:** 1 |
|
|
| sort_by | query | Sort by created_at or updated_at | No | string, <br>**Default:** updated_at |
|
|
| sort_order | query | Sort order: asc or desc | No | string, <br>**Default:** desc |
|
|
| source | query | Deprecated single source filter | No | string |
|
|
| sources | query | Filter by one or more source IDs, e.g. webapp:<app_id> or workflow:<app_id>. Exact workflow:<app_id>:<workflow_id>:<version>:<node_id> IDs remain supported. | No | [ string ] |
|
|
| start | query | Start date (YYYY-MM-DD HH:MM) | No | string |
|
|
| status | query | Deprecated single status filter | No | string |
|
|
| statuses | query | Filter by one or more of success, failed, paused | No | [ string ] |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
| conversation_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent log messages | **application/json**: [AgentLogMessageListResponse](#agentlogmessagelistresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/messages/{message_id}
|
|
Get Agent App message details by ID
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| message_id | path | Message ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Message retrieved successfully | **application/json**: [MessageDetailResponse](#messagedetailresponse)<br> |
|
|
| 404 | Agent or message not found | |
|
|
|
|
### [POST] /agent/{agent_id}/publish
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AgentPublishPayload](#agentpublishpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent draft published | **application/json**: [AgentPublishResponse](#agentpublishresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [GET] /agent/{agent_id}/referencing-workflows
|
|
List workflow apps that reference this Agent App's bound Agent (read-only)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Referencing workflows listed successfully | **application/json**: [AgentReferencingWorkflowsResponse](#agentreferencingworkflowsresponse)<br> |
|
|
| 404 | Agent not found | |
|
|
|
|
### [GET] /agent/{agent_id}/sandbox
|
|
Get basic information for an Agent App conversation sandbox
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| conversation_id | query | Agent App conversation ID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Sandbox information returned | **application/json**: [SandboxInfoResponse](#sandboxinforesponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/sandbox/files
|
|
List a directory in an Agent App conversation sandbox
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| conversation_id | query | Agent App conversation ID | Yes | string |
|
|
| path | query | Directory path relative to the sandbox workspace | No | string, <br>**Default:** . |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Listing returned | **application/json**: [SandboxListResponse](#sandboxlistresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/sandbox/files/read
|
|
Read a text/binary preview file in an Agent App conversation sandbox
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| conversation_id | query | Agent App conversation ID | Yes | string |
|
|
| path | query | File path relative to the sandbox workspace | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Preview returned | **application/json**: [SandboxReadResponse](#sandboxreadresponse)<br> |
|
|
|
|
### [POST] /agent/{agent_id}/sandbox/files/upload
|
|
Upload one Agent App sandbox file and return a signed download URL
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AgentSandboxUploadPayload](#agentsandboxuploadpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Uploaded | **application/json**: [SandboxUploadResponse](#sandboxuploadresponse)<br> |
|
|
|
|
### [POST] /agent/{agent_id}/skills/upload
|
|
Upload + standardize a Skill into an Agent App drive
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Skill uploaded into drive | **application/json**: [AgentSkillUploadResponse](#agentskilluploadresponse)<br> |
|
|
| 400 | Invalid skill package or no bound agent | |
|
|
|
|
### [DELETE] /agent/{agent_id}/skills/{slug}
|
|
Delete a standardized skill from an Agent App drive
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| slug | path | Skill slug (single path segment) | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Skill removed | **application/json**: [AgentDriveDeleteResponse](#agentdrivedeleteresponse)<br> |
|
|
|
|
### [POST] /agent/{agent_id}/skills/{slug}/infer-tools
|
|
Infer CLI tool + ENV suggestions from a standardized Agent App skill
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | Agent ID | Yes | string (uuid) |
|
|
| slug | path | Skill slug (single path segment) | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Inference result (draft suggestions, nothing persisted) | **application/json**: [SkillToolInferenceResult](#skilltoolinferenceresult)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/statistics/summary
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| end | query | End date (YYYY-MM-DD HH:MM) | No | string |
|
|
| source | query | Filter by a structured webapp:<app_id> or workflow:<app_id> source ID. Legacy invoke sources and exact workflow version/node source IDs remain supported. | No | string |
|
|
| start | query | Start date (YYYY-MM-DD HH:MM) | No | string |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent monitoring summary and chart data | **application/json**: [AgentStatisticSummaryEnvelopeResponse](#agentstatisticsummaryenveloperesponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/versions
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent versions | **application/json**: [AgentConfigSnapshotListResponse](#agentconfigsnapshotlistresponse)<br> |
|
|
|
|
### [GET] /agent/{agent_id}/versions/{version_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
| version_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent version detail | **application/json**: [AgentConfigSnapshotDetailResponse](#agentconfigsnapshotdetailresponse)<br> |
|
|
|
|
### [POST] /agent/{agent_id}/versions/{version_id}/restore
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| agent_id | path | | Yes | string (uuid) |
|
|
| version_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent version restored | **application/json**: [AgentConfigSnapshotRestoreResponse](#agentconfigsnapshotrestoreresponse)<br> |
|
|
|
|
### [GET] /all-workspaces
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| limit | query | | No | integer, <br>**Default:** 20 |
|
|
| page | query | | No | integer, <br>**Default:** 1 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [WorkspacePaginationResponse](#workspacepaginationresponse)<br> |
|
|
|
|
### [GET] /api-based-extension
|
|
Get all API-based extensions for current tenant
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [APIBasedExtensionListResponse](#apibasedextensionlistresponse)<br> |
|
|
|
|
### [POST] /api-based-extension
|
|
Create a new API-based extension
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [APIBasedExtensionPayload](#apibasedextensionpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Extension created successfully | **application/json**: [APIBasedExtensionResponse](#apibasedextensionresponse)<br> |
|
|
|
|
### [DELETE] /api-based-extension/{id}
|
|
Delete API-based extension
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| id | path | Extension ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Extension deleted successfully |
|
|
|
|
### [GET] /api-based-extension/{id}
|
|
Get API-based extension by ID
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| id | path | Extension ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [APIBasedExtensionResponse](#apibasedextensionresponse)<br> |
|
|
|
|
### [POST] /api-based-extension/{id}
|
|
Update API-based extension
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| id | path | Extension ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [APIBasedExtensionPayload](#apibasedextensionpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Extension updated successfully | **application/json**: [APIBasedExtensionResponse](#apibasedextensionresponse)<br> |
|
|
|
|
### [GET] /api-key-auth/data-source
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ApiKeyAuthDataSourceListResponse](#apikeyauthdatasourcelistresponse)<br> |
|
|
|
|
### [POST] /api-key-auth/data-source/binding
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ApiKeyAuthBindingPayload](#apikeyauthbindingpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [DELETE] /api-key-auth/data-source/{binding_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| binding_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Binding deleted successfully |
|
|
|
|
### [GET] /app-dsl-version
|
|
**Get current app DSL version for workflow clipboard compatibility**
|
|
|
|
Get current app DSL version
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AppDslVersionResponse](#appdslversionresponse)<br> |
|
|
|
|
### [GET] /app/prompt-templates
|
|
Get advanced prompt templates based on app mode and model configuration
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_mode | query | Application mode | Yes | string |
|
|
| has_context | query | Whether has context | No | string, <br>**Default:** true |
|
|
| model_mode | query | Model mode | Yes | string |
|
|
| model_name | query | Model name | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Prompt templates retrieved successfully | **application/json**: [AdvancedPromptTemplateResponse](#advancedprompttemplateresponse)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
|
|
### [GET] /apps
|
|
**Get app list**
|
|
|
|
Get list of applications with pagination and filtering
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| creator_ids | query | Filter by creator account IDs | No | [ string ] |
|
|
| is_created_by_me | query | Filter by creator | No | boolean |
|
|
| limit | query | Page size (1-100) | No | integer, <br>**Default:** 20 |
|
|
| mode | query | App mode filter | No | string, <br>**Available values:** "advanced-chat", "agent", "agent-chat", "all", "channel", "chat", "completion", "workflow", <br>**Default:** all |
|
|
| name | query | Filter by app name | No | string |
|
|
| page | query | Page number (1-99999) | No | integer, <br>**Default:** 1 |
|
|
| sort_by | query | Sort apps by last modified, recently created, or earliest created | No | string, <br>**Available values:** "earliest_created", "last_modified", "recently_created", <br>**Default:** last_modified |
|
|
| tag_ids | query | Filter by tag IDs | No | [ string ] |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AppPagination](#apppagination)<br> |
|
|
|
|
### [POST] /apps
|
|
**Create app**
|
|
|
|
Create a new application
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [CreateAppPayload](#createapppayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | App created successfully | **application/json**: [AppDetailWithSite](#appdetailwithsite)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [POST] /apps/imports
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AppImportPayload](#appimportpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Import completed | **application/json**: [Import](#import)<br> |
|
|
| 202 | Import pending confirmation | **application/json**: [Import](#import)<br> |
|
|
| 400 | Import failed | **application/json**: [Import](#import)<br> |
|
|
|
|
### [GET] /apps/imports/{app_id}/check-dependencies
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Dependencies checked | **application/json**: [CheckDependenciesResult](#checkdependenciesresult)<br> |
|
|
|
|
### [POST] /apps/imports/{import_id}/confirm
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| import_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Import confirmed | **application/json**: [Import](#import)<br> |
|
|
| 400 | Import failed | **application/json**: [Import](#import)<br> |
|
|
|
|
### [GET] /apps/recent
|
|
**Return the lightweight app cards needed by the Explore home page**
|
|
|
|
Get recently modified apps for the home Continue Work section
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| limit | query | Number of recently modified apps to return (1-8) | No | integer, <br>**Default:** 8 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RecentAppListResponse](#recentapplistresponse)<br> |
|
|
|
|
### [GET] /apps/starred
|
|
Get applications starred by the current account
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| creator_ids | query | Filter by creator account IDs | No | [ string ] |
|
|
| is_created_by_me | query | Filter by creator | No | boolean |
|
|
| limit | query | Page size (1-100) | No | integer, <br>**Default:** 20 |
|
|
| mode | query | App mode filter | No | string, <br>**Available values:** "advanced-chat", "agent", "agent-chat", "all", "channel", "chat", "completion", "workflow", <br>**Default:** all |
|
|
| name | query | Filter by app name | No | string |
|
|
| page | query | Page number (1-99999) | No | integer, <br>**Default:** 1 |
|
|
| sort_by | query | Sort apps by last modified, recently created, or earliest created | No | string, <br>**Available values:** "earliest_created", "last_modified", "recently_created", <br>**Default:** last_modified |
|
|
| tag_ids | query | Filter by tag IDs | No | [ string ] |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AppPagination](#apppagination)<br> |
|
|
|
|
### [POST] /apps/workflows/online-users
|
|
Get workflow online users
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowOnlineUsersPayload](#workflowonlineuserspayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow online users retrieved successfully | **application/json**: [WorkflowOnlineUsersResponse](#workflowonlineusersresponse)<br> |
|
|
|
|
### [DELETE] /apps/{app_id}
|
|
**Delete app**
|
|
|
|
Delete application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | App deleted successfully |
|
|
| 403 | Insufficient permissions |
|
|
|
|
### [GET] /apps/{app_id}
|
|
**Get app detail**
|
|
|
|
Get application details
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AppDetailWithSite](#appdetailwithsite)<br> |
|
|
|
|
### [PUT] /apps/{app_id}
|
|
**Update app**
|
|
|
|
Update application details
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [UpdateAppPayload](#updateapppayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | App updated successfully | **application/json**: [AppDetailWithSite](#appdetailwithsite)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [GET] /apps/{app_id}/advanced-chat/workflow-runs
|
|
**Get advanced chat app workflow run list**
|
|
|
|
Get advanced chat workflow run list
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| last_id | query | Last run ID for pagination | No | string |
|
|
| limit | query | Number of items per page (1-100) | No | integer, <br>**Default:** 20 |
|
|
| status | query | Workflow run status filter | No | string, <br>**Available values:** "failed", "partial-succeeded", "running", "stopped", "succeeded" |
|
|
| triggered_from | query | Filter by trigger source: debugging or app-run. Default: debugging | No | string, <br>**Available values:** "app-run", "debugging" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow runs retrieved successfully | **application/json**: [AdvancedChatWorkflowRunPaginationResponse](#advancedchatworkflowrunpaginationresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/advanced-chat/workflow-runs/count
|
|
**Get advanced chat workflow runs count statistics**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| status | query | Workflow run status filter | No | string, <br>**Available values:** "failed", "partial-succeeded", "running", "stopped", "succeeded" |
|
|
| time_range | query | Filter by time range (optional): e.g., 7d (7 days), 4h (4 hours), 30m (30 minutes), 30s (30 seconds). Filters by created_at field. | No | string |
|
|
| triggered_from | query | Filter by trigger source: debugging or app-run. Default: debugging | No | string, <br>**Available values:** "app-run", "debugging" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow runs count retrieved successfully | **application/json**: [WorkflowRunCountResponse](#workflowruncountresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/advanced-chat/workflows/draft/human-input/nodes/{node_id}/form/preview
|
|
**Preview human input form content and placeholders**
|
|
|
|
Get human input form preview for advanced chat workflow
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [HumanInputFormPreviewPayload](#humaninputformpreviewpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Human input form preview | **application/json**: [HumanInputFormPreviewResponse](#humaninputformpreviewresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/advanced-chat/workflows/draft/human-input/nodes/{node_id}/form/run
|
|
**Submit human input form preview**
|
|
|
|
Submit human input form preview for advanced chat workflow
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [HumanInputFormSubmitPayload](#humaninputformsubmitpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Human input form submission result | **application/json**: [HumanInputFormSubmitResponse](#humaninputformsubmitresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/advanced-chat/workflows/draft/iteration/nodes/{node_id}/run
|
|
**Run draft workflow iteration node**
|
|
|
|
Run draft workflow iteration node for advanced chat
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [IterationNodeRunPayload](#iterationnoderunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Iteration node run started successfully | **application/json**: [GeneratedAppResponse](#generatedappresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 404 | Node not found | |
|
|
|
|
### [POST] /apps/{app_id}/advanced-chat/workflows/draft/loop/nodes/{node_id}/run
|
|
**Run draft workflow loop node**
|
|
|
|
Run draft workflow loop node for advanced chat
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [LoopNodeRunPayload](#loopnoderunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Loop node run started successfully | **application/json**: [GeneratedAppResponse](#generatedappresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 404 | Node not found | |
|
|
|
|
### [POST] /apps/{app_id}/advanced-chat/workflows/draft/run
|
|
**Run draft workflow**
|
|
|
|
Run draft workflow for advanced chat application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AdvancedChatWorkflowRunPayload](#advancedchatworkflowrunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow run started successfully | **application/json**: [GeneratedAppResponse](#generatedappresponse)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
| 403 | Permission denied | |
|
|
|
|
### [GET] /apps/{app_id}/agent/config/files
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config files | **application/json**: [AgentConfigFileListResponse](#agentconfigfilelistresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/agent/config/files
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AgentConfigFileUploadPayload](#agentconfigfileuploadpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Uploaded config file | **application/json**: [AgentConfigFileUploadResponse](#agentconfigfileuploadresponse)<br> |
|
|
|
|
### [DELETE] /apps/{app_id}/agent/config/files/{name}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| name | path | Config file name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config file deleted | **application/json**: [AgentConfigDeleteResponse](#agentconfigdeleteresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/agent/config/files/{name}/download
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| name | path | Config file name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config file download URL | **application/json**: [AgentConfigDownloadResponse](#agentconfigdownloadresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/agent/config/files/{name}/preview
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| name | path | Config file name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Preview | **application/json**: [AgentConfigFilePreviewResponse](#agentconfigfilepreviewresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/agent/config/manifest
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent config manifest | **application/json**: [AgentConfigManifestResponse](#agentconfigmanifestresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/agent/config/skills
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config skills | **application/json**: [AgentConfigSkillListResponse](#agentconfigskilllistresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/agent/config/skills/upload
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Uploaded config skill | **application/json**: [AgentConfigSkillUploadResponse](#agentconfigskilluploadresponse)<br> |
|
|
|
|
### [DELETE] /apps/{app_id}/agent/config/skills/{name}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| name | path | Config skill name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config skill deleted | **application/json**: [AgentConfigDeleteResponse](#agentconfigdeleteresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/agent/config/skills/{name}/download
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| name | path | Config skill name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config skill download URL | **application/json**: [AgentConfigDownloadResponse](#agentconfigdownloadresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/agent/config/skills/{name}/files/content
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| name | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Success |
|
|
|
|
### [GET] /apps/{app_id}/agent/config/skills/{name}/files/download
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| name | path | Config skill name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| path | query | Normalized zip member path inside the skill package | Yes | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config skill file download URL | **application/json**: [AgentConfigDownloadResponse](#agentconfigdownloadresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/agent/config/skills/{name}/files/preview
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| name | path | Config skill name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| path | query | Normalized zip member path inside the skill package | Yes | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config skill file preview | **application/json**: [AgentConfigSkillFilePreviewResponse](#agentconfigskillfilepreviewresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/agent/config/skills/{name}/inspect
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| name | path | Config skill name | Yes | string |
|
|
| draft_type | query | Editable draft surface: omit or 'draft' for normal draft, 'debug_build' for build draft | No | string, <br>**Available values:** "debug_build", "draft" |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| version_id | query | Published snapshot ID for read-only version view | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Config skill inspect view | **application/json**: [AgentConfigSkillInspectResponse](#agentconfigskillinspectresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/agent/drive/files
|
|
List agent drive entries (read-only inspector; one endpoint for both tabs)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| prefix | query | Key prefix filter: '<slug>/' for one skill, 'files/' for files | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Drive entries | **application/json**: [AgentDriveListResponse](#agentdrivelistresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/agent/drive/files/download
|
|
Time-limited external signed URL for one drive value (no streaming proxy)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| key | query | Drive key, e.g. tender-analyzer/SKILL.md | Yes | string |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Signed URL | **application/json**: [AgentDriveDownloadResponse](#agentdrivedownloadresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/agent/drive/files/preview
|
|
Truncated text preview of one drive value (binary-safe; SKILL.md is the main case)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| key | query | Drive key, e.g. tender-analyzer/SKILL.md | Yes | string |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Preview | **application/json**: [AgentDrivePreviewResponse](#agentdrivepreviewresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/agent/drive/skills
|
|
List drive-backed skills for the bound agent
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
| prefix | query | Key prefix filter: '<slug>/' for one skill, 'files/' for files | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Drive skills | **application/json**: [AgentDriveSkillListResponse](#agentdriveskilllistresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/agent/drive/skills/{skill_path}/inspect
|
|
Inspect one drive-backed skill for slash-menu hover/detail UI
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| skill_path | path | Skill path/slug, e.g. tender-analyzer | Yes | string |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Drive skill inspect view | **application/json**: [AgentDriveSkillInspectResponse](#agentdriveskillinspectresponse)<br> |
|
|
|
|
### [DELETE] /apps/{app_id}/agent/files
|
|
Delete one drive file by key via drive commit-null semantics
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| key | query | Drive key, e.g. files/sample.pdf | Yes | string |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | File removed | **application/json**: [AgentDriveDeleteResponse](#agentdrivedeleteresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/agent/files
|
|
**ADD FILE: commit one uploaded file into the bound agent's drive**
|
|
|
|
Commit an uploaded file into the agent drive under files/<name> (ENG-625 D3)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AgentDriveFilePayload](#agentdrivefilepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | File committed into the agent drive | **application/json**: [AgentDriveFileCommitResponse](#agentdrivefilecommitresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/agent/logs
|
|
**Get agent logs**
|
|
|
|
Get agent execution logs for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| conversation_id | query | Conversation UUID | Yes | string |
|
|
| message_id | query | Message UUID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Agent logs retrieved successfully | **application/json**: [AgentLogResponse](#agentlogresponse)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
|
|
### [POST] /apps/{app_id}/agent/skills/upload
|
|
**Upload a Skill, validate it, and commit drive-backed skill files**
|
|
|
|
Upload + standardize a Skill into the agent drive
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Skill uploaded into drive | **application/json**: [AgentSkillUploadResponse](#agentskilluploadresponse)<br> |
|
|
| 400 | Invalid skill package or no bound agent | |
|
|
|
|
### [DELETE] /apps/{app_id}/agent/skills/{slug}
|
|
Delete a standardized skill by removing its known drive keys via commit-null
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| slug | path | Skill slug (single path segment) | Yes | string |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Skill removed | **application/json**: [AgentDriveDeleteResponse](#agentdrivedeleteresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/agent/skills/{slug}/infer-tools
|
|
**Suggest CLI tools/env for a skill**
|
|
|
|
Infer CLI tool + ENV suggestions from a standardized skill's SKILL.md (draft only, ENG-371)
|
|
Saving still goes through composer validation.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| slug | path | Skill slug (single path segment) | Yes | string |
|
|
| node_id | query | Workflow node ID (workflow composer variant) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Inference result (draft suggestions, nothing persisted) | **application/json**: [SkillToolInferenceResult](#skilltoolinferenceresult)<br> |
|
|
|
|
### [POST] /apps/{app_id}/annotation-reply/{action}
|
|
Enable or disable annotation reply for an app
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| action | path | Action to perform (enable/disable) | Yes | string |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AnnotationReplyPayload](#annotationreplypayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Action completed successfully | **application/json**: [AnnotationJobStatusResponse](#annotationjobstatusresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [GET] /apps/{app_id}/annotation-reply/{action}/status/{job_id}
|
|
Get status of annotation reply action job
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| action | path | Action type | Yes | string |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| job_id | path | Job ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Job status retrieved successfully | **application/json**: [AnnotationJobStatusDetailResponse](#annotationjobstatusdetailresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [GET] /apps/{app_id}/annotation-setting
|
|
Get annotation settings for an app
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Annotation settings retrieved successfully | **application/json**: [AnnotationSettingResponse](#annotationsettingresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [POST] /apps/{app_id}/annotation-settings/{annotation_setting_id}
|
|
Update annotation settings for an app
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| annotation_setting_id | path | Annotation setting ID | Yes | string (uuid) |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AnnotationSettingUpdatePayload](#annotationsettingupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Settings updated successfully | **application/json**: [AnnotationSettingResponse](#annotationsettingresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [DELETE] /apps/{app_id}/annotations
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Annotations deleted successfully |
|
|
|
|
### [GET] /apps/{app_id}/annotations
|
|
Get annotations for an app with pagination
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| keyword | query | Search keyword | No | string |
|
|
| limit | query | Page size | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number | No | integer, <br>**Default:** 1 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Annotations retrieved successfully | **application/json**: [AnnotationList](#annotationlist)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [POST] /apps/{app_id}/annotations
|
|
Create a new annotation for an app
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [CreateAnnotationPayload](#createannotationpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Annotation created successfully | **application/json**: [Annotation](#annotation)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [POST] /apps/{app_id}/annotations/batch-import
|
|
Batch import annotations from CSV file with rate limiting and security checks
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Batch import started successfully | **application/json**: [AnnotationBatchImportResponse](#annotationbatchimportresponse)<br> |
|
|
| 400 | No file uploaded or too many files | |
|
|
| 403 | Insufficient permissions | |
|
|
| 413 | File too large | |
|
|
| 429 | Too many requests or concurrent imports | |
|
|
|
|
### [GET] /apps/{app_id}/annotations/batch-import-status/{job_id}
|
|
Get status of batch import job
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| job_id | path | Job ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Job status retrieved successfully | **application/json**: [AnnotationJobStatusDetailResponse](#annotationjobstatusdetailresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [GET] /apps/{app_id}/annotations/count
|
|
Get count of message annotations for the app
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Annotation count retrieved successfully | **application/json**: [AnnotationCountResponse](#annotationcountresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/annotations/export
|
|
Export all annotations for an app with CSV injection protection
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Annotations exported successfully | **application/json**: [AnnotationExportList](#annotationexportlist)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [DELETE] /apps/{app_id}/annotations/{annotation_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| annotation_id | path | | Yes | string (uuid) |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Annotation deleted successfully |
|
|
|
|
### [POST] /apps/{app_id}/annotations/{annotation_id}
|
|
Update or delete an annotation
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| annotation_id | path | Annotation ID | Yes | string (uuid) |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [UpdateAnnotationPayload](#updateannotationpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Annotation updated successfully | **application/json**: [Annotation](#annotation)<br> |
|
|
| 204 | Annotation deleted successfully | |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [GET] /apps/{app_id}/annotations/{annotation_id}/hit-histories
|
|
Get hit histories for an annotation
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| annotation_id | path | Annotation ID | Yes | string (uuid) |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| limit | query | Page size | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number | No | integer, <br>**Default:** 1 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Hit histories retrieved successfully | **application/json**: [AnnotationHitHistoryList](#annotationhithistorylist)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [POST] /apps/{app_id}/api-enable
|
|
Enable or disable app API
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AppApiStatusPayload](#appapistatuspayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | API status updated successfully | **application/json**: [AppDetail](#appdetail)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [POST] /apps/{app_id}/audio-to-text
|
|
Transcript audio to text for chat messages
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | App ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Audio transcription successful | **application/json**: [AudioTranscriptResponse](#audiotranscriptresponse)<br> |
|
|
| 400 | Bad request - No audio uploaded or unsupported type | |
|
|
| 413 | Audio file too large | |
|
|
|
|
### [GET] /apps/{app_id}/chat-conversations
|
|
Get chat conversations with pagination, filtering and summary
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| annotation_status | query | Annotation status filter | No | string, <br>**Available values:** "all", "annotated", "not_annotated", <br>**Default:** all |
|
|
| end | query | End date (YYYY-MM-DD HH:MM) | No | string |
|
|
| keyword | query | Search keyword | No | string |
|
|
| limit | query | Page size (1-100) | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number | No | integer, <br>**Default:** 1 |
|
|
| sort_by | query | Sort field and direction | No | string, <br>**Available values:** "-created_at", "-updated_at", "created_at", "updated_at", <br>**Default:** -updated_at |
|
|
| start | query | Start date (YYYY-MM-DD HH:MM) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ConversationWithSummaryPagination](#conversationwithsummarypagination)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [DELETE] /apps/{app_id}/chat-conversations/{conversation_id}
|
|
Delete a chat conversation
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| conversation_id | path | Conversation ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Conversation deleted successfully |
|
|
| 403 | Insufficient permissions |
|
|
| 404 | Conversation not found |
|
|
|
|
### [GET] /apps/{app_id}/chat-conversations/{conversation_id}
|
|
Get chat conversation details
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| conversation_id | path | Conversation ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ConversationDetail](#conversationdetail)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
| 404 | Conversation not found | |
|
|
|
|
### [GET] /apps/{app_id}/chat-messages
|
|
Get chat messages for a conversation with pagination
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| conversation_id | query | Conversation ID | Yes | string |
|
|
| first_id | query | First message ID for pagination | No | string |
|
|
| limit | query | Number of messages to return (1-100) | No | integer, <br>**Default:** 20 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [MessageInfiniteScrollPaginationResponse](#messageinfinitescrollpaginationresponse)<br> |
|
|
| 404 | Conversation not found | |
|
|
|
|
### [GET] /apps/{app_id}/chat-messages/{message_id}/suggested-questions
|
|
Get suggested questions for a message
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| message_id | path | Message ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Suggested questions retrieved successfully | **application/json**: [SuggestedQuestionsResponse](#suggestedquestionsresponse)<br> |
|
|
| 404 | Message or conversation not found | |
|
|
|
|
### [POST] /apps/{app_id}/chat-messages/{task_id}/stop
|
|
Stop a running chat message generation
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| task_id | path | Task ID to stop | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Task stopped successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/completion-conversations
|
|
Get completion conversations with pagination and filtering
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| annotation_status | query | Annotation status filter | No | string, <br>**Available values:** "all", "annotated", "not_annotated", <br>**Default:** all |
|
|
| end | query | End date (YYYY-MM-DD HH:MM) | No | string |
|
|
| keyword | query | Search keyword | No | string |
|
|
| limit | query | Page size (1-100) | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number | No | integer, <br>**Default:** 1 |
|
|
| start | query | Start date (YYYY-MM-DD HH:MM) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ConversationPagination](#conversationpagination)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [DELETE] /apps/{app_id}/completion-conversations/{conversation_id}
|
|
Delete a completion conversation
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| conversation_id | path | Conversation ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Conversation deleted successfully |
|
|
| 403 | Insufficient permissions |
|
|
| 404 | Conversation not found |
|
|
|
|
### [GET] /apps/{app_id}/completion-conversations/{conversation_id}
|
|
Get completion conversation details with messages
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| conversation_id | path | Conversation ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ConversationMessageDetail](#conversationmessagedetail)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
| 404 | Conversation not found | |
|
|
|
|
### [POST] /apps/{app_id}/completion-messages
|
|
Generate completion message for debugging
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [CompletionMessagePayload](#completionmessagepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Completion generated successfully |
|
|
| 400 | Invalid request parameters |
|
|
| 404 | App not found |
|
|
|
|
### [POST] /apps/{app_id}/completion-messages/{task_id}/stop
|
|
Stop a running completion message generation
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| task_id | path | Task ID to stop | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Task stopped successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/conversation-variables
|
|
Get conversation variables for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| conversation_id | query | Conversation ID to filter variables | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Conversation variables retrieved successfully | **application/json**: [PaginatedConversationVariableResponse](#paginatedconversationvariableresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/convert-to-workflow
|
|
**Convert basic mode of chatbot app to workflow mode**
|
|
|
|
Convert application to workflow mode
|
|
Convert expert mode of chatbot app to workflow mode
|
|
Convert Completion App to Workflow App
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ConvertToWorkflowPayload](#converttoworkflowpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Application converted to workflow successfully | **application/json**: [NewAppResponse](#newappresponse)<br> |
|
|
| 400 | Application cannot be converted | |
|
|
| 403 | Permission denied | |
|
|
|
|
### [POST] /apps/{app_id}/copy
|
|
**Copy app**
|
|
|
|
Create a copy of an existing application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID to copy | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [CopyAppPayload](#copyapppayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | App copied successfully | **application/json**: [AppDetailWithSite](#appdetailwithsite)<br> |
|
|
| 202 | App copy requires confirmation | **application/json**: [AppImportResponse](#appimportresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [GET] /apps/{app_id}/export
|
|
**Export app**
|
|
|
|
Export application configuration as DSL
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID to export | Yes | string (uuid) |
|
|
| include_secret | query | Include secrets in export | No | boolean |
|
|
| workflow_id | query | Specific workflow ID to export | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | App exported successfully | **application/json**: [AppExportResponse](#appexportresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [POST] /apps/{app_id}/feedbacks
|
|
Create or update message feedback (like/dislike)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MessageFeedbackPayload](#messagefeedbackpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Feedback updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
| 404 | Message not found | |
|
|
|
|
### [GET] /apps/{app_id}/feedbacks/export
|
|
Export user feedback data for Google Sheets
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| end_date | query | End date (YYYY-MM-DD) | No | string |
|
|
| format | query | Export format | No | string, <br>**Available values:** "csv", "json", <br>**Default:** csv |
|
|
| from_source | query | Filter by feedback source | No | string, <br>**Available values:** "admin", "user" |
|
|
| has_comment | query | Only include feedback with comments | No | boolean |
|
|
| rating | query | Filter by rating | No | string, <br>**Available values:** "dislike", "like" |
|
|
| start_date | query | Start date (YYYY-MM-DD) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Feedback data exported successfully | **application/json**: [TextFileResponse](#textfileresponse)<br> |
|
|
| 400 | Invalid parameters | |
|
|
| 500 | Internal server error | |
|
|
|
|
### [POST] /apps/{app_id}/icon
|
|
Update application icon
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AppIconPayload](#appiconpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Icon updated successfully | **application/json**: [AppDetail](#appdetail)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [GET] /apps/{app_id}/messages/{message_id}
|
|
Get message details by ID
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| message_id | path | Message ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Message retrieved successfully | **application/json**: [MessageDetailResponse](#messagedetailresponse)<br> |
|
|
| 404 | Message not found | |
|
|
|
|
### [POST] /apps/{app_id}/model-config
|
|
**Modify the app model config and dataset joins in one request transaction**
|
|
|
|
Update application model configuration
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ModelConfigRequest](#modelconfigrequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Model configuration updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 400 | Invalid configuration | |
|
|
| 404 | App not found | |
|
|
|
|
### [POST] /apps/{app_id}/name
|
|
Check if app name is available
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AppNamePayload](#appnamepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Name availability checked | **application/json**: [AppDetail](#appdetail)<br> |
|
|
|
|
### [POST] /apps/{app_id}/publish-to-creators-platform
|
|
**Publish app to Creators Platform**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RedirectUrlResponse](#redirecturlresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/server
|
|
Get MCP server configuration for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | MCP server configuration retrieved successfully | **application/json**: [AppMCPServerResponse](#appmcpserverresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/server
|
|
Create MCP server configuration for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MCPServerCreatePayload](#mcpservercreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | MCP server configuration created successfully | **application/json**: [AppMCPServerResponse](#appmcpserverresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [PUT] /apps/{app_id}/server
|
|
Update MCP server configuration for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MCPServerUpdatePayload](#mcpserverupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | MCP server configuration updated successfully | **application/json**: [AppMCPServerResponse](#appmcpserverresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
| 404 | Server not found | |
|
|
|
|
### [POST] /apps/{app_id}/site
|
|
Update application site configuration
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AppSiteUpdatePayload](#appsiteupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Site configuration updated successfully | **application/json**: [AppSiteResponse](#appsiteresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
| 404 | App not found | |
|
|
|
|
### [POST] /apps/{app_id}/site-enable
|
|
Enable or disable app site
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AppSiteStatusPayload](#appsitestatuspayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Site status updated successfully | **application/json**: [AppDetail](#appdetail)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [POST] /apps/{app_id}/site/access-token-reset
|
|
Reset access token for application site
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Access token reset successfully | **application/json**: [AppSiteResponse](#appsiteresponse)<br> |
|
|
| 403 | Insufficient permissions (admin/owner required) | |
|
|
| 404 | App or site not found | |
|
|
|
|
### [DELETE] /apps/{app_id}/star
|
|
Remove the current account's star from an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 404 | App not found | |
|
|
|
|
### [POST] /apps/{app_id}/star
|
|
Star an application for the current account
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 404 | App not found | |
|
|
|
|
### [GET] /apps/{app_id}/statistics/average-response-time
|
|
Get average response time statistics for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| end | query | End date (YYYY-MM-DD HH:MM) | No | string |
|
|
| start | query | Start date (YYYY-MM-DD HH:MM) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Average response time statistics retrieved successfully | **application/json**: [AverageResponseTimeStatisticResponse](#averageresponsetimestatisticresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/statistics/average-session-interactions
|
|
Get average session interaction statistics for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| end | query | End date (YYYY-MM-DD HH:MM) | No | string |
|
|
| start | query | Start date (YYYY-MM-DD HH:MM) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Average session interaction statistics retrieved successfully | **application/json**: [AverageSessionInteractionStatisticResponse](#averagesessioninteractionstatisticresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/statistics/daily-conversations
|
|
Get daily conversation statistics for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| end | query | End date (YYYY-MM-DD HH:MM) | No | string |
|
|
| start | query | Start date (YYYY-MM-DD HH:MM) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Daily conversation statistics retrieved successfully | **application/json**: [DailyConversationStatisticResponse](#dailyconversationstatisticresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/statistics/daily-end-users
|
|
Get daily terminal/end-user statistics for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| end | query | End date (YYYY-MM-DD HH:MM) | No | string |
|
|
| start | query | Start date (YYYY-MM-DD HH:MM) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Daily terminal statistics retrieved successfully | **application/json**: [DailyTerminalStatisticResponse](#dailyterminalstatisticresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/statistics/daily-messages
|
|
Get daily message statistics for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| end | query | End date (YYYY-MM-DD HH:MM) | No | string |
|
|
| start | query | Start date (YYYY-MM-DD HH:MM) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Daily message statistics retrieved successfully | **application/json**: [DailyMessageStatisticResponse](#dailymessagestatisticresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/statistics/token-costs
|
|
Get daily token cost statistics for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| end | query | End date (YYYY-MM-DD HH:MM) | No | string |
|
|
| start | query | Start date (YYYY-MM-DD HH:MM) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Daily token cost statistics retrieved successfully | **application/json**: [DailyTokenCostStatisticResponse](#dailytokencoststatisticresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/statistics/tokens-per-second
|
|
Get tokens per second statistics for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| end | query | End date (YYYY-MM-DD HH:MM) | No | string |
|
|
| start | query | Start date (YYYY-MM-DD HH:MM) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Tokens per second statistics retrieved successfully | **application/json**: [TokensPerSecondStatisticResponse](#tokenspersecondstatisticresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/statistics/user-satisfaction-rate
|
|
Get user satisfaction rate statistics for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| end | query | End date (YYYY-MM-DD HH:MM) | No | string |
|
|
| start | query | Start date (YYYY-MM-DD HH:MM) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | User satisfaction rate statistics retrieved successfully | **application/json**: [UserSatisfactionRateStatisticResponse](#usersatisfactionratestatisticresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/text-to-audio
|
|
Convert text to speech for chat messages
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | App ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TextToSpeechPayload](#texttospeechpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Text to speech conversion successful |
|
|
| 400 | Bad request - Invalid parameters |
|
|
|
|
### [GET] /apps/{app_id}/text-to-audio/voices
|
|
Get available TTS voices for a specific language
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | App ID | Yes | string (uuid) |
|
|
| language | query | Language code | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | TTS voices retrieved successfully | **application/json**: [TextToSpeechVoiceListResponse](#texttospeechvoicelistresponse)<br> |
|
|
| 400 | Invalid language parameter | |
|
|
|
|
### [GET] /apps/{app_id}/trace
|
|
**Get app trace**
|
|
|
|
Get app tracing configuration
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trace configuration retrieved successfully | **application/json**: [AppTraceResponse](#apptraceresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/trace
|
|
Update app tracing configuration
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [AppTracePayload](#apptracepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trace configuration updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [DELETE] /apps/{app_id}/trace-config
|
|
**Delete an existing trace app configuration**
|
|
|
|
Delete an existing tracing configuration for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| tracing_provider | query | Tracing provider name | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Tracing configuration deleted successfully |
|
|
| 400 | Invalid request parameters or configuration not found |
|
|
| 403 | Insufficient permissions |
|
|
|
|
### [GET] /apps/{app_id}/trace-config
|
|
Get tracing configuration for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| tracing_provider | query | Tracing provider name | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Tracing configuration retrieved successfully | **application/json**: [TraceAppConfigResponse](#traceappconfigresponse)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
|
|
### [PATCH] /apps/{app_id}/trace-config
|
|
**Update an existing trace app configuration**
|
|
|
|
Update an existing tracing configuration for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TraceConfigPayload](#traceconfigpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Tracing configuration updated successfully | **application/json**: [TraceAppConfigResponse](#traceappconfigresponse)<br> |
|
|
| 400 | Invalid request parameters or configuration not found | |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [POST] /apps/{app_id}/trace-config
|
|
**Create a new trace app configuration**
|
|
|
|
Create a new tracing configuration for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TraceConfigPayload](#traceconfigpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Tracing configuration created successfully | **application/json**: [TraceAppConfigResponse](#traceappconfigresponse)<br> |
|
|
| 400 | Invalid request parameters or configuration already exists | |
|
|
| 403 | Insufficient permissions | |
|
|
|
|
### [POST] /apps/{app_id}/trigger-enable
|
|
**Update app trigger (enable/disable)**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserEnable](#parserenable)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [WorkflowTriggerResponse](#workflowtriggerresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/triggers
|
|
**Get app triggers list**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [WorkflowTriggerListResponse](#workflowtriggerlistresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflow-app-logs
|
|
**Get workflow app logs**
|
|
|
|
Get workflow application execution logs
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| created_at__after | query | Filter logs created after this timestamp | No | dateTime |
|
|
| created_at__before | query | Filter logs created before this timestamp | No | dateTime |
|
|
| created_by_account | query | Filter by account | No | string |
|
|
| created_by_end_user_session_id | query | Filter by end user session ID | No | string |
|
|
| detail | query | Whether to return detailed logs | No | boolean |
|
|
| keyword | query | Search keyword for filtering logs | No | string |
|
|
| limit | query | Number of items per page (1-100) | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number (1-99999) | No | integer, <br>**Default:** 1 |
|
|
| status | query | Execution status filter (succeeded, failed, stopped, partial-succeeded) | No | string, <br>**Available values:** "failed", "partial-succeeded", "paused", "running", "scheduled", "stopped", "succeeded" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow app logs retrieved successfully | **application/json**: [WorkflowAppLogPaginationResponse](#workflowapplogpaginationresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflow-archived-logs
|
|
**Get workflow archived logs**
|
|
|
|
Get workflow archived execution logs
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| created_at__after | query | Filter logs created after this timestamp | No | dateTime |
|
|
| created_at__before | query | Filter logs created before this timestamp | No | dateTime |
|
|
| created_by_account | query | Filter by account | No | string |
|
|
| created_by_end_user_session_id | query | Filter by end user session ID | No | string |
|
|
| detail | query | Whether to return detailed logs | No | boolean |
|
|
| keyword | query | Search keyword for filtering logs | No | string |
|
|
| limit | query | Number of items per page (1-100) | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number (1-99999) | No | integer, <br>**Default:** 1 |
|
|
| status | query | Execution status filter (succeeded, failed, stopped, partial-succeeded) | No | string, <br>**Available values:** "failed", "partial-succeeded", "paused", "running", "scheduled", "stopped", "succeeded" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow archived logs retrieved successfully | **application/json**: [WorkflowArchivedLogPaginationResponse](#workflowarchivedlogpaginationresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflow-runs
|
|
**Get workflow run list**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| last_id | query | Last run ID for pagination | No | string |
|
|
| limit | query | Number of items per page (1-100) | No | integer, <br>**Default:** 20 |
|
|
| status | query | Workflow run status filter | No | string, <br>**Available values:** "failed", "partial-succeeded", "running", "stopped", "succeeded" |
|
|
| triggered_from | query | Filter by trigger source: debugging or app-run. Default: debugging | No | string, <br>**Available values:** "app-run", "debugging" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow runs retrieved successfully | **application/json**: [WorkflowRunPaginationResponse](#workflowrunpaginationresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflow-runs/count
|
|
**Get workflow runs count statistics**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| status | query | Workflow run status filter | No | string, <br>**Available values:** "failed", "partial-succeeded", "running", "stopped", "succeeded" |
|
|
| time_range | query | Filter by time range (optional): e.g., 7d (7 days), 4h (4 hours), 30m (30 minutes), 30s (30 seconds). Filters by created_at field. | No | string |
|
|
| triggered_from | query | Filter by trigger source: debugging or app-run. Default: debugging | No | string, <br>**Available values:** "app-run", "debugging" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow runs count retrieved successfully | **application/json**: [WorkflowRunCountResponse](#workflowruncountresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflow-runs/tasks/{task_id}/stop
|
|
**Stop workflow task**
|
|
|
|
Stop running workflow task
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| task_id | path | Task ID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Task stopped successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 404 | Task not found | |
|
|
|
|
### [GET] /apps/{app_id}/workflow-runs/{run_id}
|
|
**Get workflow run detail**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| run_id | path | Workflow run ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow run detail retrieved successfully | **application/json**: [WorkflowRunDetailResponse](#workflowrundetailresponse)<br> |
|
|
| 404 | Workflow run not found | |
|
|
|
|
### [GET] /apps/{app_id}/workflow-runs/{run_id}/export
|
|
Generate a download URL for an archived workflow run.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| run_id | path | Workflow run ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Export URL generated | **application/json**: [WorkflowRunExportResponse](#workflowrunexportresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflow-runs/{run_id}/node-executions
|
|
**Get workflow run node execution list**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| run_id | path | Workflow run ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Node executions retrieved successfully | **application/json**: [WorkflowRunNodeExecutionListResponse](#workflowrunnodeexecutionlistresponse)<br> |
|
|
| 404 | Workflow run not found | |
|
|
|
|
### [GET] /apps/{app_id}/workflow-runs/{workflow_run_id}/agent-nodes/{node_id}/sandbox/files
|
|
List a directory in a workflow Agent node sandbox
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Workflow Agent node ID | Yes | string |
|
|
| workflow_run_id | path | Workflow run ID | Yes | string (uuid) |
|
|
| node_execution_id | query | Optional workflow node execution ID. When omitted, the latest active session for the node is used. | No | string |
|
|
| path | query | Directory path relative to the sandbox workspace | No | string, <br>**Default:** . |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Listing returned | **application/json**: [SandboxListResponse](#sandboxlistresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflow-runs/{workflow_run_id}/agent-nodes/{node_id}/sandbox/files/read
|
|
Read a text/binary preview file in a workflow Agent node sandbox
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Workflow Agent node ID | Yes | string |
|
|
| workflow_run_id | path | Workflow run ID | Yes | string (uuid) |
|
|
| node_execution_id | query | Optional workflow node execution ID. When omitted, the latest active session for the node is used. | No | string |
|
|
| path | query | File path relative to the sandbox workspace | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Preview returned | **application/json**: [SandboxReadResponse](#sandboxreadresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflow-runs/{workflow_run_id}/agent-nodes/{node_id}/sandbox/files/upload
|
|
Upload one workflow Agent sandbox file and return a signed download URL
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| node_id | path | | Yes | string |
|
|
| workflow_run_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowAgentSandboxUploadPayload](#workflowagentsandboxuploadpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Uploaded | **application/json**: [SandboxUploadResponse](#sandboxuploadresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflow/comments
|
|
**Get all comments for a workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Comments retrieved successfully | **application/json**: [WorkflowCommentBasicList](#workflowcommentbasiclist)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflow/comments
|
|
**Create a new workflow comment**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowCommentCreatePayload](#workflowcommentcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Comment created successfully | **application/json**: [WorkflowCommentCreate](#workflowcommentcreate)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflow/comments/mention-users
|
|
**Get all users in current tenant for mentions**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Mentionable users retrieved successfully | **application/json**: [WorkflowCommentMentionUsersPayload](#workflowcommentmentionuserspayload)<br> |
|
|
|
|
### [DELETE] /apps/{app_id}/workflow/comments/{comment_id}
|
|
**Delete a workflow comment**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| comment_id | path | Comment ID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Comment deleted successfully |
|
|
|
|
### [GET] /apps/{app_id}/workflow/comments/{comment_id}
|
|
**Get a specific workflow comment**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| comment_id | path | Comment ID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Comment retrieved successfully | **application/json**: [WorkflowCommentDetail](#workflowcommentdetail)<br> |
|
|
|
|
### [PUT] /apps/{app_id}/workflow/comments/{comment_id}
|
|
**Update a workflow comment**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| comment_id | path | Comment ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowCommentUpdatePayload](#workflowcommentupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Comment updated successfully | **application/json**: [WorkflowCommentUpdate](#workflowcommentupdate)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflow/comments/{comment_id}/replies
|
|
**Add a reply to a workflow comment**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| comment_id | path | Comment ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowCommentReplyPayload](#workflowcommentreplypayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Reply created successfully | **application/json**: [WorkflowCommentReplyCreate](#workflowcommentreplycreate)<br> |
|
|
|
|
### [DELETE] /apps/{app_id}/workflow/comments/{comment_id}/replies/{reply_id}
|
|
**Delete a comment reply**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| comment_id | path | Comment ID | Yes | string |
|
|
| reply_id | path | Reply ID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Reply deleted successfully |
|
|
|
|
### [PUT] /apps/{app_id}/workflow/comments/{comment_id}/replies/{reply_id}
|
|
**Update a comment reply**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| comment_id | path | Comment ID | Yes | string |
|
|
| reply_id | path | Reply ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowCommentReplyPayload](#workflowcommentreplypayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Reply updated successfully | **application/json**: [WorkflowCommentReplyUpdate](#workflowcommentreplyupdate)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflow/comments/{comment_id}/resolve
|
|
**Resolve a workflow comment**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| comment_id | path | Comment ID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Comment resolved successfully | **application/json**: [WorkflowCommentResolve](#workflowcommentresolve)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflow/statistics/average-app-interactions
|
|
Get workflow average app interaction statistics
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| end | query | End date and time (YYYY-MM-DD HH:MM) | No | string |
|
|
| start | query | Start date and time (YYYY-MM-DD HH:MM) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Average app interaction statistics retrieved successfully | **application/json**: [WorkflowAverageAppInteractionStatisticResponse](#workflowaverageappinteractionstatisticresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflow/statistics/daily-conversations
|
|
Get workflow daily runs statistics
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| end | query | End date and time (YYYY-MM-DD HH:MM) | No | string |
|
|
| start | query | Start date and time (YYYY-MM-DD HH:MM) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Daily runs statistics retrieved successfully | **application/json**: [WorkflowDailyRunsStatisticResponse](#workflowdailyrunsstatisticresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflow/statistics/daily-terminals
|
|
Get workflow daily terminals statistics
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| end | query | End date and time (YYYY-MM-DD HH:MM) | No | string |
|
|
| start | query | Start date and time (YYYY-MM-DD HH:MM) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Daily terminals statistics retrieved successfully | **application/json**: [WorkflowDailyTerminalsStatisticResponse](#workflowdailyterminalsstatisticresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflow/statistics/token-costs
|
|
Get workflow daily token cost statistics
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| end | query | End date and time (YYYY-MM-DD HH:MM) | No | string |
|
|
| start | query | Start date and time (YYYY-MM-DD HH:MM) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Daily token cost statistics retrieved successfully | **application/json**: [WorkflowDailyTokenCostStatisticResponse](#workflowdailytokencoststatisticresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflows
|
|
**Get published workflows**
|
|
|
|
Get all published workflows for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| limit | query | | No | integer, <br>**Default:** 10 |
|
|
| named_only | query | | No | boolean |
|
|
| page | query | | No | integer, <br>**Default:** 1 |
|
|
| user_id | query | | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Published workflows retrieved successfully | **application/json**: [WorkflowPaginationResponse](#workflowpaginationresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflows/default-workflow-block-configs
|
|
**Get default block config**
|
|
|
|
Get default block configurations for workflow
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Default block configurations retrieved successfully | **application/json**: [DefaultBlockConfigsResponse](#defaultblockconfigsresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflows/default-workflow-block-configs/{block_type}
|
|
**Get default block config**
|
|
|
|
Get default block configuration by type
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| block_type | path | Block type | Yes | string |
|
|
| q | query | | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Default block configuration retrieved successfully | **application/json**: [DefaultBlockConfigResponse](#defaultblockconfigresponse)<br> |
|
|
| 404 | Block type not found | |
|
|
|
|
### [GET] /apps/{app_id}/workflows/draft
|
|
**Get draft workflow**
|
|
|
|
Get draft workflow for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Draft workflow retrieved successfully | **application/json**: [WorkflowResponse](#workflowresponse)<br> |
|
|
| 404 | Draft workflow not found | |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft
|
|
**Sync draft workflow**
|
|
|
|
Sync draft workflow configuration
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [SyncDraftWorkflowPayload](#syncdraftworkflowpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Draft workflow synced successfully | **application/json**: [SyncDraftWorkflowResponse](#syncdraftworkflowresponse)<br> |
|
|
| 400 | Invalid workflow configuration | |
|
|
| 403 | Permission denied | |
|
|
|
|
### [GET] /apps/{app_id}/workflows/draft/conversation-variables
|
|
Get conversation variables for workflow
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Conversation variables retrieved successfully | **application/json**: [WorkflowDraftVariableList](#workflowdraftvariablelist)<br> |
|
|
| 404 | Draft workflow not found | |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/conversation-variables
|
|
Update conversation variables for workflow draft
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ConversationVariableUpdatePayload](#conversationvariableupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Conversation variables updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflows/draft/environment-variables
|
|
**Get draft workflow**
|
|
|
|
Get environment variables for workflow
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Environment variables retrieved successfully | **application/json**: [EnvironmentVariableListResponse](#environmentvariablelistresponse)<br> |
|
|
| 404 | Draft workflow not found | |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/environment-variables
|
|
Update environment variables for workflow draft
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [EnvironmentVariableUpdatePayload](#environmentvariableupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Environment variables updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/features
|
|
Update draft workflow features
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowFeaturesPayload](#workflowfeaturespayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow features updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/human-input/nodes/{node_id}/delivery-test
|
|
**Test human input delivery**
|
|
|
|
Test human input delivery for workflow
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [HumanInputDeliveryTestPayload](#humaninputdeliverytestpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Human input delivery test result | **application/json**: [EmptyObjectResponse](#emptyobjectresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/human-input/nodes/{node_id}/form/preview
|
|
**Preview human input form content and placeholders**
|
|
|
|
Get human input form preview for workflow
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [HumanInputFormPreviewPayload](#humaninputformpreviewpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Human input form preview | **application/json**: [HumanInputFormPreviewResponse](#humaninputformpreviewresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/human-input/nodes/{node_id}/form/run
|
|
**Submit human input form preview**
|
|
|
|
Submit human input form preview for workflow
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [HumanInputFormSubmitPayload](#humaninputformsubmitpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Human input form submission result | **application/json**: [HumanInputFormSubmitResponse](#humaninputformsubmitresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/iteration/nodes/{node_id}/run
|
|
**Run draft workflow iteration node**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [IterationNodeRunPayload](#iterationnoderunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow iteration node run started successfully | **application/json**: [GeneratedAppResponse](#generatedappresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 404 | Node not found | |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/loop/nodes/{node_id}/run
|
|
**Run draft workflow loop node**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [LoopNodeRunPayload](#loopnoderunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow loop node run started successfully | **application/json**: [GeneratedAppResponse](#generatedappresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 404 | Node not found | |
|
|
|
|
### [GET] /apps/{app_id}/workflows/draft/nodes/{node_id}/agent-composer
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snapshot_id | query | | No | string |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| node_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow agent composer state | **application/json**: [WorkflowAgentComposerResponse](#workflowagentcomposerresponse)<br> |
|
|
|
|
### [PUT] /apps/{app_id}/workflows/draft/nodes/{node_id}/agent-composer
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| node_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ComposerSavePayload](#composersavepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow agent composer saved | **application/json**: [WorkflowAgentComposerResponse](#workflowagentcomposerresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflows/draft/nodes/{node_id}/agent-composer/candidates
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| node_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow agent composer candidates | **application/json**: [AgentComposerCandidatesResponse](#agentcomposercandidatesresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/nodes/{node_id}/agent-composer/copy-from-roster
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| node_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowComposerCopyFromRosterPayload](#workflowcomposercopyfromrosterpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow roster agent copied to inline agent | **application/json**: [WorkflowAgentComposerResponse](#workflowagentcomposerresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/nodes/{node_id}/agent-composer/impact
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| node_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ComposerSavePayload](#composersavepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow agent composer impact | **application/json**: [AgentComposerImpactResponse](#agentcomposerimpactresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/nodes/{node_id}/agent-composer/save-to-roster
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| node_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ComposerSavePayload](#composersavepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow agent composer saved to roster | **application/json**: [WorkflowAgentComposerResponse](#workflowagentcomposerresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/nodes/{node_id}/agent-composer/validate
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| node_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ComposerSavePayload](#composersavepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow agent composer validation result | **application/json**: [AgentComposerValidateResponse](#agentcomposervalidateresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflows/draft/nodes/{node_id}/last-run
|
|
Get last run result for draft workflow node
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Node last run retrieved successfully | **application/json**: [WorkflowRunNodeExecutionResponse](#workflowrunnodeexecutionresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 404 | Node last run not found | |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/nodes/{node_id}/run
|
|
**Run draft workflow node**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DraftWorkflowNodeRunPayload](#draftworkflownoderunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Node run started successfully | **application/json**: [WorkflowRunNodeExecutionResponse](#workflowrunnodeexecutionresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 404 | Node not found | |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/nodes/{node_id}/trigger/run
|
|
**Poll for trigger events and execute single node when event arrives**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger event received and node executed successfully | **application/json**: [GeneratedAppResponse](#generatedappresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 500 | Internal server error | |
|
|
|
|
### [DELETE] /apps/{app_id}/workflows/draft/nodes/{node_id}/variables
|
|
Delete all variables for a specific node
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| node_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Node variables deleted successfully |
|
|
|
|
### [GET] /apps/{app_id}/workflows/draft/nodes/{node_id}/variables
|
|
Get variables for a specific node
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Node variables retrieved successfully | **application/json**: [WorkflowDraftVariableList](#workflowdraftvariablelist)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/run
|
|
**Run draft workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DraftWorkflowRunPayload](#draftworkflowrunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Draft workflow run started successfully | **application/json**: [GeneratedAppResponse](#generatedappresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
|
|
### [GET] /apps/{app_id}/workflows/draft/runs/{run_id}/node-outputs
|
|
Snapshot of every node's declared outputs for a draft workflow run.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| run_id | path | Workflow run ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow run node outputs | **application/json**: [WorkflowRunSnapshotView](#workflowrunsnapshotview)<br> |
|
|
| 404 | Workflow run not found | |
|
|
|
|
### [GET] /apps/{app_id}/workflows/draft/runs/{run_id}/node-outputs/events
|
|
Server-Sent Events stream of inspector deltas for a draft workflow run.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| run_id | path | Workflow run ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow run node output event stream | **application/json**: [EventStreamResponse](#eventstreamresponse)<br> |
|
|
| 404 | Workflow run not found | |
|
|
|
|
### [GET] /apps/{app_id}/workflows/draft/runs/{run_id}/node-outputs/{node_id}
|
|
One node's declared outputs for a draft workflow run.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID inside the workflow graph | Yes | string |
|
|
| run_id | path | Workflow run ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow run node output detail | **application/json**: [NodeOutputsView](#nodeoutputsview)<br> |
|
|
| 404 | Workflow run / node not found | |
|
|
|
|
### [GET] /apps/{app_id}/workflows/draft/runs/{run_id}/node-outputs/{node_id}/{output_name}/preview
|
|
Full value for one declared output, including signed download URL for files.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID inside the workflow graph | Yes | string |
|
|
| output_name | path | Declared output name as exposed by Composer | Yes | string |
|
|
| run_id | path | Workflow run ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow run node output preview | **application/json**: [OutputPreviewView](#outputpreviewview)<br> |
|
|
| 404 | Workflow run / node / output not found | |
|
|
|
|
### [GET] /apps/{app_id}/workflows/draft/system-variables
|
|
Get system variables for workflow
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | System variables retrieved successfully | **application/json**: [WorkflowDraftVariableList](#workflowdraftvariablelist)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/trigger/run
|
|
**Poll for trigger events and execute full workflow when event arrives**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DraftWorkflowTriggerRunRequest](#draftworkflowtriggerrunrequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger event received and workflow executed successfully | **application/json**: [GeneratedAppResponse](#generatedappresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 500 | Internal server error | |
|
|
|
|
### [POST] /apps/{app_id}/workflows/draft/trigger/run-all
|
|
**Full workflow debug when the start node is a trigger**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DraftWorkflowTriggerRunAllPayload](#draftworkflowtriggerrunallpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow executed successfully | **application/json**: [GeneratedAppResponse](#generatedappresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 500 | Internal server error | |
|
|
|
|
### [DELETE] /apps/{app_id}/workflows/draft/variables
|
|
Delete all draft workflow variables
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Workflow variables deleted successfully |
|
|
|
|
### [GET] /apps/{app_id}/workflows/draft/variables
|
|
**Get draft workflow**
|
|
|
|
Get draft workflow variables
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| limit | query | Items per page | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number | No | integer, <br>**Default:** 1 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow variables retrieved successfully | **application/json**: [WorkflowDraftVariableListWithoutValue](#workflowdraftvariablelistwithoutvalue)<br> |
|
|
|
|
### [DELETE] /apps/{app_id}/workflows/draft/variables/{variable_id}
|
|
Delete a workflow variable
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| variable_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Variable deleted successfully |
|
|
| 404 | Variable not found |
|
|
|
|
### [GET] /apps/{app_id}/workflows/draft/variables/{variable_id}
|
|
Get a specific workflow variable
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| variable_id | path | Variable ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Variable retrieved successfully | **application/json**: [WorkflowDraftVariable](#workflowdraftvariable)<br> |
|
|
| 404 | Variable not found | |
|
|
|
|
### [PATCH] /apps/{app_id}/workflows/draft/variables/{variable_id}
|
|
Update a workflow variable
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| variable_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowDraftVariableUpdatePayload](#workflowdraftvariableupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Variable updated successfully | **application/json**: [WorkflowDraftVariable](#workflowdraftvariable)<br> |
|
|
| 404 | Variable not found | |
|
|
|
|
### [PUT] /apps/{app_id}/workflows/draft/variables/{variable_id}/reset
|
|
Reset a workflow variable to its default value
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| variable_id | path | Variable ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Variable reset successfully | **application/json**: [WorkflowDraftVariable](#workflowdraftvariable)<br> |
|
|
| 204 | Variable reset (no content) | |
|
|
| 404 | Variable not found | |
|
|
|
|
### [GET] /apps/{app_id}/workflows/publish
|
|
**Get published workflow**
|
|
|
|
Get published workflow for an application
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Published workflow retrieved successfully, or null if not found | **application/json**: [WorkflowResponse](#workflowresponse)<br> |
|
|
|
|
### [POST] /apps/{app_id}/workflows/publish
|
|
**Publish workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [PublishWorkflowPayload](#publishworkflowpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow published successfully | **application/json**: [WorkflowPublishResponse](#workflowpublishresponse)<br> |
|
|
|
|
### [GET] /apps/{app_id}/workflows/published/runs/{run_id}/node-outputs
|
|
Snapshot of every node's declared outputs for a published workflow run.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| run_id | path | Workflow run ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow run node outputs | **application/json**: [WorkflowRunSnapshotView](#workflowrunsnapshotview)<br> |
|
|
| 404 | Workflow run not found | |
|
|
|
|
### [GET] /apps/{app_id}/workflows/published/runs/{run_id}/node-outputs/events
|
|
Server-Sent Events stream of inspector deltas for a published workflow run.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| run_id | path | Workflow run ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow run node output event stream | **application/json**: [EventStreamResponse](#eventstreamresponse)<br> |
|
|
| 404 | Workflow run not found | |
|
|
|
|
### [GET] /apps/{app_id}/workflows/published/runs/{run_id}/node-outputs/{node_id}
|
|
One node's declared outputs for a published workflow run.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID inside the workflow graph | Yes | string |
|
|
| run_id | path | Workflow run ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow run node output detail | **application/json**: [NodeOutputsView](#nodeoutputsview)<br> |
|
|
| 404 | Workflow run / node not found | |
|
|
|
|
### [GET] /apps/{app_id}/workflows/published/runs/{run_id}/node-outputs/{node_id}/{output_name}/preview
|
|
Full value for one declared output of a published run.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| node_id | path | Node ID inside the workflow graph | Yes | string |
|
|
| output_name | path | Declared output name as exposed by Composer | Yes | string |
|
|
| run_id | path | Workflow run ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow run node output preview | **application/json**: [OutputPreviewView](#outputpreviewview)<br> |
|
|
| 404 | Workflow run / node / output not found | |
|
|
|
|
### [GET] /apps/{app_id}/workflows/triggers/webhook
|
|
**Get webhook trigger for a node**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | query | | Yes | string |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [WebhookTriggerResponse](#webhooktriggerresponse)<br> |
|
|
|
|
### [DELETE] /apps/{app_id}/workflows/{workflow_id}
|
|
**Delete workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| workflow_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Workflow deleted successfully |
|
|
|
|
### [PATCH] /apps/{app_id}/workflows/{workflow_id}
|
|
**Update workflow attributes**
|
|
|
|
Update workflow by ID
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| workflow_id | path | Workflow ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowUpdatePayload](#workflowupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow updated successfully | **application/json**: [WorkflowResponse](#workflowresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 404 | Workflow not found | |
|
|
|
|
### [POST] /apps/{app_id}/workflows/{workflow_id}/restore
|
|
Restore a published workflow version into the draft workflow
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | Application ID | Yes | string (uuid) |
|
|
| workflow_id | path | Published workflow ID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow restored successfully | **application/json**: [WorkflowRestoreResponse](#workflowrestoreresponse)<br> |
|
|
| 400 | Source workflow must be published | |
|
|
| 404 | Workflow not found | |
|
|
|
|
### [GET] /apps/{resource_id}/api-keys
|
|
**Get all API keys for an app**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| resource_id | path | App ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | API keys retrieved successfully | **application/json**: [ApiKeyList](#apikeylist)<br> |
|
|
|
|
### [POST] /apps/{resource_id}/api-keys
|
|
**Create a new API key for an app**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| resource_id | path | App ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | API key created successfully | **application/json**: [ApiKeyItem](#apikeyitem)<br> |
|
|
| 400 | Maximum keys exceeded | |
|
|
|
|
### [DELETE] /apps/{resource_id}/api-keys/{api_key_id}
|
|
**Delete an API key for an app**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| api_key_id | path | API key ID | Yes | string (uuid) |
|
|
| resource_id | path | App ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | API key deleted successfully |
|
|
|
|
### [GET] /apps/{server_id}/server/refresh
|
|
Refresh MCP server configuration and regenerate server code
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| server_id | path | Server ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | MCP server refreshed successfully | **application/json**: [AppMCPServerResponse](#appmcpserverresponse)<br> |
|
|
| 403 | Insufficient permissions | |
|
|
| 404 | Server not found | |
|
|
|
|
### [GET] /auth/plugin/datasource/default-list
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Default datasource credentials retrieved successfully | **application/json**: [DatasourceProviderAuthListResponse](#datasourceproviderauthlistresponse)<br> |
|
|
|
|
### [GET] /auth/plugin/datasource/list
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Datasource credentials retrieved successfully | **application/json**: [DatasourceProviderAuthListResponse](#datasourceproviderauthlistresponse)<br> |
|
|
|
|
### [GET] /auth/plugin/datasource/{provider_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Datasource credentials retrieved successfully | **application/json**: [DatasourceCredentialListResponse](#datasourcecredentiallistresponse)<br> |
|
|
|
|
### [POST] /auth/plugin/datasource/{provider_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DatasourceCredentialPayload](#datasourcecredentialpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Datasource credential created successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [DELETE] /auth/plugin/datasource/{provider_id}/custom-client
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /auth/plugin/datasource/{provider_id}/custom-client
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DatasourceCustomClientPayload](#datasourcecustomclientpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Datasource OAuth custom client saved successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /auth/plugin/datasource/{provider_id}/default
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DatasourceDefaultPayload](#datasourcedefaultpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /auth/plugin/datasource/{provider_id}/delete
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DatasourceCredentialDeletePayload](#datasourcecredentialdeletepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /auth/plugin/datasource/{provider_id}/update
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DatasourceCredentialUpdatePayload](#datasourcecredentialupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Datasource credential updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /auth/plugin/datasource/{provider_id}/update-name
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DatasourceUpdateNamePayload](#datasourceupdatenamepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /billing/invoices
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [BillingInvoiceResponse](#billinginvoiceresponse)<br> |
|
|
|
|
### [PUT] /billing/partners/{partner_key}/tenants
|
|
Sync partner tenants bindings
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| partner_key | path | Partner key | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [PartnerTenantsPayload](#partnertenantspayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Tenants synced to partner successfully | **application/json**: [BillingResponse](#billingresponse)<br> |
|
|
| 400 | Invalid partner information | |
|
|
|
|
### [GET] /billing/subscription
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| interval | query | Billing interval | Yes | string, <br>**Available values:** "month", "year" |
|
|
| plan | query | Subscription plan | Yes | string, <br>**Available values:** "professional", "team" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [BillingResponse](#billingresponse)<br> |
|
|
|
|
### [GET] /code-based-extension
|
|
Get code-based extension data by module name
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| module | query | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [CodeBasedExtensionResponse](#codebasedextensionresponse)<br> |
|
|
|
|
### [GET] /compliance/download
|
|
Get compliance document download link
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| doc_name | query | Compliance document name | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ComplianceDownloadResponse](#compliancedownloadresponse)<br> |
|
|
|
|
### [GET] /data-source/integrates
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [DataSourceIntegrateListResponse](#datasourceintegratelistresponse)<br> |
|
|
|
|
### [PATCH] /data-source/integrates
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /data-source/integrates/{binding_id}/{action}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| action | path | | Yes | string |
|
|
| binding_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [DataSourceIntegrateListResponse](#datasourceintegratelistresponse)<br> |
|
|
|
|
### [PATCH] /data-source/integrates/{binding_id}/{action}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| action | path | | Yes | string |
|
|
| binding_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /datasets
|
|
Get list of datasets
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| ids | query | Filter by dataset IDs | No | [ string ] |
|
|
| include_all | query | Include all datasets | No | boolean |
|
|
| keyword | query | Search keyword | No | string |
|
|
| limit | query | Number of items per page | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number | No | integer, <br>**Default:** 1 |
|
|
| tag_ids | query | Filter by tag IDs | No | [ string ] |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Datasets retrieved successfully | **application/json**: [DatasetListResponse](#datasetlistresponse)<br> |
|
|
|
|
### [POST] /datasets
|
|
Create a new dataset
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DatasetCreatePayload](#datasetcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Dataset created successfully | **application/json**: [DatasetDetailResponse](#datasetdetailresponse)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
|
|
### [GET] /datasets/api-base-info
|
|
Get dataset API base information
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | API base info retrieved successfully | **application/json**: [ApiBaseUrlResponse](#apibaseurlresponse)<br> |
|
|
|
|
### [GET] /datasets/api-keys
|
|
Get dataset API keys
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | API keys retrieved successfully | **application/json**: [ApiKeyList](#apikeylist)<br> |
|
|
|
|
### [POST] /datasets/api-keys
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | API key created successfully | **application/json**: [ApiKeyItem](#apikeyitem)<br> |
|
|
| 400 | Maximum keys exceeded | |
|
|
|
|
### [DELETE] /datasets/api-keys/{api_key_id}
|
|
Delete dataset API key
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| api_key_id | path | API key ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | API key deleted successfully |
|
|
|
|
### [GET] /datasets/batch_import_status/{job_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| job_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Batch import status | **application/json**: [SegmentBatchImportStatusResponse](#segmentbatchimportstatusresponse)<br> |
|
|
|
|
### [POST] /datasets/batch_import_status/{job_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| job_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [BatchImportPayload](#batchimportpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Batch import started | **application/json**: [SegmentBatchImportStatusResponse](#segmentbatchimportstatusresponse)<br> |
|
|
|
|
### [POST] /datasets/external
|
|
Create external knowledge dataset
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ExternalDatasetCreatePayload](#externaldatasetcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | External dataset created successfully | **application/json**: [DatasetDetailResponse](#datasetdetailresponse)<br> |
|
|
| 400 | Invalid parameters | |
|
|
| 403 | Permission denied | |
|
|
|
|
### [GET] /datasets/external-knowledge-api
|
|
Get external knowledge API templates
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| keyword | query | Search keyword | No | string |
|
|
| limit | query | Number of items per page | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number | No | integer, <br>**Default:** 1 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | External API templates retrieved successfully | **application/json**: [ExternalKnowledgeApiListResponse](#externalknowledgeapilistresponse)<br> |
|
|
|
|
### [POST] /datasets/external-knowledge-api
|
|
Create external knowledge API template
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ExternalKnowledgeApiPayload](#externalknowledgeapipayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | External API template created successfully | **application/json**: [ExternalKnowledgeApiResponse](#externalknowledgeapiresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
|
|
### [DELETE] /datasets/external-knowledge-api/{external_knowledge_api_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| external_knowledge_api_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | External knowledge API deleted successfully |
|
|
|
|
### [GET] /datasets/external-knowledge-api/{external_knowledge_api_id}
|
|
Get external knowledge API template details
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| external_knowledge_api_id | path | External knowledge API ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | External API template retrieved successfully | **application/json**: [ExternalKnowledgeApiResponse](#externalknowledgeapiresponse)<br> |
|
|
| 404 | Template not found | |
|
|
|
|
### [PATCH] /datasets/external-knowledge-api/{external_knowledge_api_id}
|
|
Update external knowledge API template
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| external_knowledge_api_id | path | External knowledge API ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ExternalKnowledgeApiPayload](#externalknowledgeapipayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | External API template updated successfully | **application/json**: [ExternalKnowledgeApiResponse](#externalknowledgeapiresponse)<br> |
|
|
| 404 | Template not found | |
|
|
|
|
### [GET] /datasets/external-knowledge-api/{external_knowledge_api_id}/use-check
|
|
Check if external knowledge API is being used
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| external_knowledge_api_id | path | External knowledge API ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Usage check completed successfully | **application/json**: [UsageCountResponse](#usagecountresponse)<br> |
|
|
|
|
### [POST] /datasets/indexing-estimate
|
|
Estimate dataset indexing cost
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [IndexingEstimatePayload](#indexingestimatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Indexing estimate calculated successfully | **application/json**: [IndexingEstimateResponse](#indexingestimateresponse)<br> |
|
|
|
|
### [POST] /datasets/init
|
|
Initialize dataset with documents
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeConfig](#knowledgeconfig)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Dataset initialized successfully | **application/json**: [DatasetAndDocumentResponse](#datasetanddocumentresponse)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
|
|
### [GET] /datasets/metadata/built-in
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Built-in fields retrieved successfully | **application/json**: [DatasetMetadataBuiltInFieldsResponse](#datasetmetadatabuiltinfieldsresponse)<br> |
|
|
|
|
### [POST] /datasets/notion-indexing-estimate
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [NotionEstimatePayload](#notionestimatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [IndexingEstimate](#indexingestimate)<br> |
|
|
|
|
### [GET] /datasets/process-rule
|
|
Get dataset document processing rules
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| document_id | query | Document ID (optional) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Process rules retrieved successfully | **application/json**: [ProcessRuleResponse](#processruleresponse)<br> |
|
|
|
|
### [GET] /datasets/retrieval-setting
|
|
Get dataset retrieval settings
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Retrieval settings retrieved successfully | **application/json**: [RetrievalSettingResponse](#retrievalsettingresponse)<br> |
|
|
|
|
### [GET] /datasets/retrieval-setting/{vector_type}
|
|
Get mock dataset retrieval settings by vector type
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| vector_type | path | Vector store type | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Mock retrieval settings retrieved successfully | **application/json**: [RetrievalSettingResponse](#retrievalsettingresponse)<br> |
|
|
|
|
### [DELETE] /datasets/{dataset_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Dataset deleted successfully |
|
|
|
|
### [GET] /datasets/{dataset_id}
|
|
Get dataset details
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Dataset retrieved successfully | **application/json**: [DatasetDetailWithPartialMembersResponse](#datasetdetailwithpartialmembersresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 404 | Dataset not found | |
|
|
|
|
### [PATCH] /datasets/{dataset_id}
|
|
Update dataset details
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DatasetUpdatePayload](#datasetupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Dataset updated successfully | **application/json**: [DatasetDetailWithPartialMembersResponse](#datasetdetailwithpartialmembersresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 404 | Dataset not found | |
|
|
|
|
### [POST] /datasets/{dataset_id}/api-keys/{status}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| status | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /datasets/{dataset_id}/auto-disable-logs
|
|
Get dataset auto disable logs
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Auto disable logs retrieved successfully | **application/json**: [AutoDisableLogsResponse](#autodisablelogsresponse)<br> |
|
|
| 404 | Dataset not found | |
|
|
|
|
### [GET] /datasets/{dataset_id}/batch/{batch}/indexing-estimate
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| batch | path | | Yes | string |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Indexing estimate calculated successfully | **application/json**: [IndexingEstimateResponse](#indexingestimateresponse)<br> |
|
|
|
|
### [GET] /datasets/{dataset_id}/batch/{batch}/indexing-status
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| batch | path | | Yes | string |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Indexing status retrieved successfully | **application/json**: [DocumentStatusListResponse](#documentstatuslistresponse)<br> |
|
|
|
|
### [DELETE] /datasets/{dataset_id}/documents
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Documents deleted successfully |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents
|
|
Get documents in a dataset
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| fetch | query | Fetch full details (default: false) | No | string |
|
|
| keyword | query | Search keyword | No | string |
|
|
| limit | query | Number of items per page (default: 20) | No | string |
|
|
| page | query | Page number (default: 1) | No | string |
|
|
| sort | query | Sort order (default: -created_at) | No | string |
|
|
| status | query | Filter documents by display status | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Documents retrieved successfully | **application/json**: [DocumentWithSegmentsListResponse](#documentwithsegmentslistresponse)<br> |
|
|
|
|
### [POST] /datasets/{dataset_id}/documents
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeConfig](#knowledgeconfig)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Documents created successfully | **application/json**: [DatasetAndDocumentResponse](#datasetanddocumentresponse)<br> |
|
|
|
|
### [POST] /datasets/{dataset_id}/documents/download-zip
|
|
**Stream a ZIP archive containing the requested uploaded documents**
|
|
|
|
Download selected dataset documents as a single ZIP archive (upload-file only)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DocumentBatchDownloadZipPayload](#documentbatchdownloadzippayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | ZIP archive downloaded successfully |
|
|
|
|
### [POST] /datasets/{dataset_id}/documents/generate-summary
|
|
**Generate summary index for specified documents**
|
|
|
|
Generate summary index for documents
|
|
This endpoint checks if the dataset configuration supports summary generation
|
|
(indexing_technique must be 'high_quality' and summary_index_setting.enable must be true),
|
|
then asynchronously generates summary indexes for the provided documents.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [GenerateSummaryPayload](#generatesummarypayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Summary generation started successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 400 | Invalid request or dataset configuration | |
|
|
| 403 | Permission denied | |
|
|
| 404 | Dataset not found | |
|
|
|
|
### [POST] /datasets/{dataset_id}/documents/metadata
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MetadataOperationData](#metadataoperationdata)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Documents metadata updated successfully |
|
|
|
|
### [PATCH] /datasets/{dataset_id}/documents/status/{action}/batch
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| action | path | | Yes | string |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [DELETE] /datasets/{dataset_id}/documents/{document_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| document_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Document deleted successfully |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}
|
|
Get document details
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
| metadata | query | Metadata inclusion (all/only/without) | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document retrieved successfully | **application/json**: [DocumentDetailResponse](#documentdetailresponse)<br> |
|
|
| 404 | Document not found | |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}/download
|
|
Get a signed download URL for a dataset document's original uploaded file
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| document_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Download URL generated successfully | **application/json**: [UrlResponse](#urlresponse)<br> |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}/indexing-estimate
|
|
Estimate document indexing cost
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Indexing estimate calculated successfully | **application/json**: [IndexingEstimateResponse](#indexingestimateresponse)<br> |
|
|
| 400 | Document already finished | |
|
|
| 404 | Document not found | |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}/indexing-status
|
|
Get document indexing status
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Indexing status retrieved successfully | **application/json**: [DocumentStatusResponse](#documentstatusresponse)<br> |
|
|
| 404 | Document not found | |
|
|
|
|
### [PUT] /datasets/{dataset_id}/documents/{document_id}/metadata
|
|
Update document metadata
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DocumentMetadataUpdatePayload](#documentmetadataupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document metadata updated successfully | **application/json**: [SimpleResultMessageResponse](#simpleresultmessageresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 404 | Document not found | |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}/notion/sync
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| document_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}/pipeline-execution-log
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| document_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Pipeline execution log retrieved successfully | **application/json**: [DocumentPipelineExecutionLogResponse](#documentpipelineexecutionlogresponse)<br> |
|
|
|
|
### [PATCH] /datasets/{dataset_id}/documents/{document_id}/processing/pause
|
|
**pause document**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| document_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Document paused successfully |
|
|
|
|
### [PATCH] /datasets/{dataset_id}/documents/{document_id}/processing/resume
|
|
**recover document**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| document_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Document resumed successfully |
|
|
|
|
### [PATCH] /datasets/{dataset_id}/documents/{document_id}/processing/{action}
|
|
Update document processing status (pause/resume)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| action | path | Action to perform (pause/resume) | Yes | string |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Processing status updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 400 | Invalid action | |
|
|
| 404 | Document not found | |
|
|
|
|
### [POST] /datasets/{dataset_id}/documents/{document_id}/rename
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| document_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DocumentRenamePayload](#documentrenamepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Document renamed successfully | **application/json**: [DocumentResponse](#documentresponse)<br> |
|
|
|
|
### [POST] /datasets/{dataset_id}/documents/{document_id}/segment
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [SegmentCreatePayload](#segmentcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Segment created successfully | **application/json**: [SegmentDetailResponse](#segmentdetailresponse)<br> |
|
|
|
|
### [PATCH] /datasets/{dataset_id}/documents/{document_id}/segment/{action}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| action | path | Action | Yes | string |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
| segment_id | query | Segment IDs | No | [ string ] |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [DELETE] /datasets/{dataset_id}/documents/{document_id}/segments
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
| segment_id | query | Segment IDs | No | [ string ] |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Segments deleted successfully |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}/segments
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
| enabled | query | | No | string, <br>**Default:** all |
|
|
| hit_count_gte | query | | No | integer |
|
|
| keyword | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 20 |
|
|
| page | query | | No | integer, <br>**Default:** 1 |
|
|
| status | query | | No | [ string ] |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Segments retrieved successfully | **application/json**: [ConsoleSegmentListResponse](#consolesegmentlistresponse)<br> |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}/segments/batch_import
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| document_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Batch import status | **application/json**: [SegmentBatchImportStatusResponse](#segmentbatchimportstatusresponse)<br> |
|
|
|
|
### [POST] /datasets/{dataset_id}/documents/{document_id}/segments/batch_import
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| document_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [BatchImportPayload](#batchimportpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Batch import started | **application/json**: [SegmentBatchImportStatusResponse](#segmentbatchimportstatusresponse)<br> |
|
|
|
|
### [DELETE] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
| segment_id | path | Segment ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Segment deleted successfully |
|
|
|
|
### [PATCH] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
| segment_id | path | Segment ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [SegmentUpdatePayload](#segmentupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Segment updated successfully | **application/json**: [SegmentDetailResponse](#segmentdetailresponse)<br> |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}/child_chunks
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
| segment_id | path | Parent segment ID | Yes | string (uuid) |
|
|
| keyword | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 20 |
|
|
| page | query | | No | integer, <br>**Default:** 1 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Child chunks retrieved successfully | **application/json**: [ChildChunkListResponse](#childchunklistresponse)<br> |
|
|
|
|
### [PATCH] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}/child_chunks
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
| segment_id | path | Parent segment ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ChildChunkBatchUpdatePayload](#childchunkbatchupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Child chunks updated successfully | **application/json**: [ChildChunkBatchUpdateResponse](#childchunkbatchupdateresponse)<br> |
|
|
|
|
### [POST] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}/child_chunks
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
| segment_id | path | Parent segment ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ChildChunkCreatePayload](#childchunkcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Child chunk created successfully | **application/json**: [ChildChunkDetailResponse](#childchunkdetailresponse)<br> |
|
|
|
|
### [DELETE] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}/child_chunks/{child_chunk_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| child_chunk_id | path | Child chunk ID | Yes | string (uuid) |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
| segment_id | path | Parent segment ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Child chunk deleted successfully |
|
|
|
|
### [PATCH] /datasets/{dataset_id}/documents/{document_id}/segments/{segment_id}/child_chunks/{child_chunk_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| child_chunk_id | path | Child chunk ID | Yes | string (uuid) |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
| segment_id | path | Parent segment ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ChildChunkUpdatePayload](#childchunkupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Child chunk updated successfully | **application/json**: [ChildChunkDetailResponse](#childchunkdetailresponse)<br> |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}/summary-status
|
|
**Get summary index generation status for a document**
|
|
|
|
Get summary index generation status for a document
|
|
Returns:
|
|
- total_segments: Total number of segments in the document
|
|
- summary_status: Dictionary with status counts
|
|
- completed: Number of summaries completed
|
|
- generating: Number of summaries being generated
|
|
- error: Number of summaries with errors
|
|
- not_started: Number of segments without summary records
|
|
- timeout: Number of summaries that timed out
|
|
- summaries: List of summary records with status and content preview
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
| document_id | path | Document ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Summary status retrieved successfully | **application/json**: [DocumentSummaryStatusResponse](#documentsummarystatusresponse)<br> |
|
|
| 404 | Document not found | |
|
|
|
|
### [GET] /datasets/{dataset_id}/documents/{document_id}/website-sync
|
|
**sync website document**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| document_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /datasets/{dataset_id}/error-docs
|
|
Get dataset error documents
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Error documents retrieved successfully | **application/json**: [ErrorDocsResponse](#errordocsresponse)<br> |
|
|
| 404 | Dataset not found | |
|
|
|
|
### [POST] /datasets/{dataset_id}/external-hit-testing
|
|
Test external knowledge retrieval for dataset
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ExternalHitTestingPayload](#externalhittestingpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | External hit testing completed successfully | **application/json**: [ExternalHitTestingResponse](#externalhittestingresponse)<br> |
|
|
| 400 | Invalid parameters | |
|
|
| 404 | Dataset not found | |
|
|
|
|
### [POST] /datasets/{dataset_id}/hit-testing
|
|
Test dataset knowledge retrieval
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [HitTestingPayload](#hittestingpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Hit testing completed successfully | **application/json**: [HitTestingResponse](#hittestingresponse)<br> |
|
|
| 400 | Invalid parameters | |
|
|
| 404 | Dataset not found | |
|
|
|
|
### [GET] /datasets/{dataset_id}/indexing-status
|
|
Get dataset indexing status
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Indexing status retrieved successfully | **application/json**: [DocumentStatusListResponse](#documentstatuslistresponse)<br> |
|
|
|
|
### [GET] /datasets/{dataset_id}/metadata
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Metadata retrieved successfully | **application/json**: [DatasetMetadataListResponse](#datasetmetadatalistresponse)<br> |
|
|
|
|
### [POST] /datasets/{dataset_id}/metadata
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MetadataArgs](#metadataargs)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Metadata created successfully | **application/json**: [DatasetMetadataResponse](#datasetmetadataresponse)<br> |
|
|
|
|
### [POST] /datasets/{dataset_id}/metadata/built-in/{action}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| action | path | | Yes | string |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Action completed successfully |
|
|
|
|
### [DELETE] /datasets/{dataset_id}/metadata/{metadata_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| metadata_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Metadata deleted successfully |
|
|
|
|
### [PATCH] /datasets/{dataset_id}/metadata/{metadata_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| metadata_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MetadataUpdatePayload](#metadataupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Metadata updated successfully | **application/json**: [DatasetMetadataResponse](#datasetmetadataresponse)<br> |
|
|
|
|
### [GET] /datasets/{dataset_id}/notion/sync
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /datasets/{dataset_id}/permission-part-users
|
|
Get dataset permission user list
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Permission users retrieved successfully | **application/json**: [PartialMemberListResponse](#partialmemberlistresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
| 404 | Dataset not found | |
|
|
|
|
### [GET] /datasets/{dataset_id}/queries
|
|
Get dataset query history
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Query history retrieved successfully | **application/json**: [DatasetQueryListResponse](#datasetquerylistresponse)<br> |
|
|
|
|
### [GET] /datasets/{dataset_id}/related-apps
|
|
Get applications related to dataset
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Related apps retrieved successfully | **application/json**: [RelatedAppListResponse](#relatedapplistresponse)<br> |
|
|
|
|
### [POST] /datasets/{dataset_id}/retry
|
|
**retry document**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DocumentRetryPayload](#documentretrypayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Documents retry started successfully |
|
|
|
|
### [GET] /datasets/{dataset_id}/use-check
|
|
Check if dataset is in use
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | Dataset ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Dataset use status retrieved successfully | **application/json**: [UsageCheckResponse](#usagecheckresponse)<br> |
|
|
|
|
### [GET] /datasets/{resource_id}/api-keys
|
|
**Get all API keys for a dataset**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| resource_id | path | Dataset ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | API keys retrieved successfully | **application/json**: [ApiKeyList](#apikeylist)<br> |
|
|
|
|
### [POST] /datasets/{resource_id}/api-keys
|
|
**Create a new API key for a dataset**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| resource_id | path | Dataset ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | API key created successfully | **application/json**: [ApiKeyItem](#apikeyitem)<br> |
|
|
| 400 | Maximum keys exceeded | |
|
|
|
|
### [DELETE] /datasets/{resource_id}/api-keys/{api_key_id}
|
|
**Delete an API key for a dataset**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| api_key_id | path | API key ID | Yes | string (uuid) |
|
|
| resource_id | path | Dataset ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | API key deleted successfully |
|
|
|
|
### [POST] /email-code-login
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [EmailPayload](#emailpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultDataResponse](#simpleresultdataresponse)<br> |
|
|
|
|
### [POST] /email-code-login/validity
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [EmailCodeLoginPayload](#emailcodeloginpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /email-register
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [EmailRegisterResetPayload](#emailregisterresetpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [EmailRegisterResetResponse](#emailregisterresetresponse)<br> |
|
|
|
|
### [POST] /email-register/send-email
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [EmailRegisterSendPayload](#emailregistersendpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultDataResponse](#simpleresultdataresponse)<br> |
|
|
|
|
### [POST] /email-register/validity
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [EmailRegisterValidityPayload](#emailregistervaliditypayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [VerificationTokenResponse](#verificationtokenresponse)<br> |
|
|
|
|
### [GET] /explore/apps
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| language | query | Language code for recommended app localization | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RecommendedAppListResponse](#recommendedapplistresponse)<br> |
|
|
|
|
### [GET] /explore/apps/learn-dify
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| language | query | Language code for recommended app localization | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [LearnDifyAppListResponse](#learndifyapplistresponse)<br> |
|
|
|
|
### [GET] /explore/apps/{app_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RecommendedAppDetailNullableResponse](#recommendedappdetailnullableresponse)<br> |
|
|
|
|
### [GET] /features
|
|
**Get feature configuration for current tenant**
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [FeatureModel](#featuremodel)<br> |
|
|
|
|
### [GET] /features/vector-space
|
|
**Get vector-space usage and limit for current tenant**
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [LimitationModel](#limitationmodel)<br> |
|
|
|
|
### [GET] /files/support-type
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AllowedExtensionsResponse](#allowedextensionsresponse)<br> |
|
|
|
|
### [GET] /files/upload
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [UploadConfig](#uploadconfig)<br> |
|
|
|
|
### [POST] /files/upload
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"file"**: binary, **"source"**: string, <br>**Available values:** "datasets" }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | File uploaded successfully | **application/json**: [FileResponse](#fileresponse)<br> |
|
|
|
|
### [GET] /files/{file_id}/preview
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| file_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [TextContentResponse](#textcontentresponse)<br> |
|
|
|
|
### [POST] /forgot-password
|
|
Send password reset email
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ForgotPasswordSendPayload](#forgotpasswordsendpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Email sent successfully | **application/json**: [ForgotPasswordEmailResponse](#forgotpasswordemailresponse)<br> |
|
|
| 400 | Invalid email or rate limit exceeded | |
|
|
|
|
### [POST] /forgot-password/resets
|
|
Reset password with verification token
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ForgotPasswordResetPayload](#forgotpasswordresetpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Password reset successfully | **application/json**: [ForgotPasswordResetResponse](#forgotpasswordresetresponse)<br> |
|
|
| 400 | Invalid token or password mismatch | |
|
|
|
|
### [POST] /forgot-password/validity
|
|
Verify password reset code
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ForgotPasswordCheckPayload](#forgotpasswordcheckpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Code verified successfully | **application/json**: [ForgotPasswordCheckResponse](#forgotpasswordcheckresponse)<br> |
|
|
| 400 | Invalid code or token | |
|
|
|
|
### [GET] /form/human_input/{form_token}
|
|
**Get human input form definition by form token**
|
|
|
|
GET /console/api/form/human_input/<form_token>
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| form_token | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ConsoleHumanInputFormDefinitionResponse](#consolehumaninputformdefinitionresponse)<br> |
|
|
|
|
### [POST] /form/human_input/{form_token}
|
|
**Submit human input form by form token**
|
|
|
|
POST /console/api/form/human_input/<form_token>
|
|
|
|
Request body:
|
|
{
|
|
"inputs": {
|
|
"content": "User input content"
|
|
},
|
|
"action": "Approve"
|
|
}
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| form_token | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [HumanInputFormSubmitPayload](#humaninputformsubmitpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ConsoleHumanInputFormSubmitResponse](#consolehumaninputformsubmitresponse)<br> |
|
|
|
|
### [POST] /info
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [TenantInfoResponse](#tenantinforesponse)<br> |
|
|
|
|
### [GET] /installed-apps
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | query | App ID to filter by | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [InstalledAppListResponse](#installedapplistresponse)<br> |
|
|
|
|
### [POST] /installed-apps
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [InstalledAppCreatePayload](#installedappcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleMessageResponse](#simplemessageresponse)<br> |
|
|
|
|
### [DELETE] /installed-apps/{installed_app_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | App uninstalled successfully |
|
|
|
|
### [PATCH] /installed-apps/{installed_app_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [InstalledAppUpdatePayload](#installedappupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultMessageResponse](#simpleresultmessageresponse)<br> |
|
|
|
|
### [POST] /installed-apps/{installed_app_id}/audio-to-text
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AudioTranscriptResponse](#audiotranscriptresponse)<br> |
|
|
|
|
### [POST] /installed-apps/{installed_app_id}/chat-messages
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ChatMessagePayload](#chatmessagepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Success |
|
|
|
|
### [POST] /installed-apps/{installed_app_id}/chat-messages/{task_id}/stop
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /installed-apps/{installed_app_id}/completion-messages
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [CompletionMessageExplorePayload](#completionmessageexplorepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Success |
|
|
|
|
### [POST] /installed-apps/{installed_app_id}/completion-messages/{task_id}/stop
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /installed-apps/{installed_app_id}/conversations
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| last_id | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 20 |
|
|
| pinned | query | | No | boolean |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ConversationInfiniteScrollPagination](#conversationinfinitescrollpagination)<br> |
|
|
|
|
### [DELETE] /installed-apps/{installed_app_id}/conversations/{c_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| c_id | path | | Yes | string (uuid) |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Conversation deleted successfully |
|
|
|
|
### [POST] /installed-apps/{installed_app_id}/conversations/{c_id}/name
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| c_id | path | | Yes | string (uuid) |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ConversationRenamePayload](#conversationrenamepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Conversation renamed successfully | **application/json**: [SimpleConversation](#simpleconversation)<br> |
|
|
|
|
### [PATCH] /installed-apps/{installed_app_id}/conversations/{c_id}/pin
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| c_id | path | | Yes | string (uuid) |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ResultResponse](#resultresponse)<br> |
|
|
|
|
### [PATCH] /installed-apps/{installed_app_id}/conversations/{c_id}/unpin
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| c_id | path | | Yes | string (uuid) |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ResultResponse](#resultresponse)<br> |
|
|
|
|
### [GET] /installed-apps/{installed_app_id}/messages
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| conversation_id | query | Conversation ID. | Yes | string |
|
|
| first_id | query | The ID of the first chat record on the current page. Omit this value to fetch the latest messages; for subsequent pages, use the first message ID from the current list to fetch older messages. | No | string |
|
|
| limit | query | Number of chat history messages to return per request. | No | integer, <br>**Default:** 20 |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ExploreMessageInfiniteScrollPagination](#exploremessageinfinitescrollpagination)<br> |
|
|
|
|
### [POST] /installed-apps/{installed_app_id}/messages/{message_id}/feedbacks
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
| message_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MessageFeedbackPayload](#messagefeedbackpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Feedback submitted successfully | **application/json**: [ResultResponse](#resultresponse)<br> |
|
|
|
|
### [GET] /installed-apps/{installed_app_id}/messages/{message_id}/more-like-this
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| response_mode | query | | Yes | string, <br>**Available values:** "blocking", "streaming" |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
| message_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Success |
|
|
|
|
### [GET] /installed-apps/{installed_app_id}/messages/{message_id}/suggested-questions
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
| message_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SuggestedQuestionsResponse](#suggestedquestionsresponse)<br> |
|
|
|
|
### [GET] /installed-apps/{installed_app_id}/meta
|
|
**Get app meta**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ExploreAppMetaResponse](#exploreappmetaresponse)<br> |
|
|
|
|
### [GET] /installed-apps/{installed_app_id}/parameters
|
|
**Retrieve app parameters**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [Parameters](#parameters)<br> |
|
|
|
|
### [GET] /installed-apps/{installed_app_id}/saved-messages
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| last_id | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 20 |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SavedMessageInfiniteScrollPagination](#savedmessageinfinitescrollpagination)<br> |
|
|
|
|
### [POST] /installed-apps/{installed_app_id}/saved-messages
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [SavedMessageCreatePayload](#savedmessagecreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ResultResponse](#resultresponse)<br> |
|
|
|
|
### [DELETE] /installed-apps/{installed_app_id}/saved-messages/{message_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
| message_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Saved message deleted successfully |
|
|
|
|
### [POST] /installed-apps/{installed_app_id}/text-to-audio
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TextToAudioPayload](#texttoaudiopayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AudioBinaryResponse](#audiobinaryresponse)<br> |
|
|
|
|
### [POST] /installed-apps/{installed_app_id}/workflows/run
|
|
**Run workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowRunPayload](#workflowrunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Success |
|
|
|
|
### [POST] /installed-apps/{installed_app_id}/workflows/tasks/{task_id}/stop
|
|
**Stop workflow task**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| installed_app_id | path | | Yes | string (uuid) |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /instruction-generate
|
|
Generate instruction for workflow nodes or general use
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [InstructionGeneratePayload](#instructiongeneratepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Instruction generated successfully | **application/json**: [GeneratorResponse](#generatorresponse)<br> |
|
|
| 400 | Invalid request parameters or flow/workflow not found | |
|
|
| 402 | Provider quota exceeded | |
|
|
|
|
### [POST] /instruction-generate/template
|
|
Get instruction generation template
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [InstructionTemplatePayload](#instructiontemplatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Template retrieved successfully | **application/json**: [SimpleDataResponse](#simpledataresponse)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
|
|
### [GET] /knowledge-fs/.well-known/jwks.json
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS Capability v2 public keys | **application/json**: [KnowledgeFSJWKSResponse](#knowledgefsjwksresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| limit | query | | No | integer, <br>**Default:** 20 |
|
|
| page | query | | No | integer, <br>**Default:** 1 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS spaces | **application/json**: [KnowledgeFSSpaceListResponse](#knowledgefsspacelistresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSpaceCreatePayload](#knowledgefsspacecreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS provisioning accepted | **application/json**: [KnowledgeFSSpaceCreateResponse](#knowledgefsspacecreateresponse)<br> |
|
|
|
|
### [DELETE] /knowledge-fs/spaces/{control_space_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | KnowledgeFS deletion accepted |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS space | **application/json**: [KnowledgeFSSpaceDetailResponse](#knowledgefsspacedetailresponse)<br> |
|
|
|
|
### [PATCH] /knowledge-fs/spaces/{control_space_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSpaceUpdatePayload](#knowledgefsspaceupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS space updated | **application/json**: [KnowledgeFSSpaceDetailResponse](#knowledgefsspacedetailresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/app-bindings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS app bindings | **application/json**: [KnowledgeFSAppBindingListResponse](#knowledgefsappbindinglistresponse)<br> |
|
|
|
|
### [PUT] /knowledge-fs/spaces/{control_space_id}/app-bindings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSAppBindingPayload](#knowledgefsappbindingpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS app binding enabled | **application/json**: [KnowledgeFSAppBindingResponse](#knowledgefsappbindingresponse)<br> |
|
|
|
|
### [DELETE] /knowledge-fs/spaces/{control_space_id}/app-bindings/{caller_kind}/{app_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string |
|
|
| caller_kind | path | | Yes | string |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | KnowledgeFS app binding revoked |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/background-tasks
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 50 |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS background tasks | **application/json**: [KnowledgeFSBackgroundTaskListResponse](#knowledgefsbackgroundtasklistresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/background-tasks/{task_kind}/{task_id}/cancel
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| task_id | path | | Yes | string |
|
|
| task_kind | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS background task canceled | **application/json**: [KnowledgeFSBackgroundTaskResponse](#knowledgefsbackgroundtaskresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/background-tasks/{task_kind}/{task_id}/retry
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| task_id | path | | Yes | string |
|
|
| task_kind | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS background task retried | **application/json**: [KnowledgeFSBackgroundTaskResponse](#knowledgefsbackgroundtaskresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/bulk-jobs/{job_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| job_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS bulk job | **application/json**: [KnowledgeFSBulkJobResponse](#knowledgefsbulkjobresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/credentials
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS credentials | **application/json**: [KnowledgeFSCredentialListResponse](#knowledgefscredentiallistresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/credentials
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSCredentialCreatePayload](#knowledgefscredentialcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | KnowledgeFS credential created | **application/json**: [KnowledgeFSCredentialCreateResponse](#knowledgefscredentialcreateresponse)<br> |
|
|
|
|
### [DELETE] /knowledge-fs/spaces/{control_space_id}/credentials/{credential_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| credential_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | KnowledgeFS credential revoked |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/documents
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS documents | **application/json**: [KnowledgeFSDocumentListResponse](#knowledgefsdocumentlistresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/documents
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS document accepted for processing | **application/json**: [KnowledgeFSDocumentUploadAcceptedResponse](#knowledgefsdocumentuploadacceptedresponse)<br> |
|
|
|
|
### [DELETE] /knowledge-fs/spaces/{control_space_id}/documents/bulk
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| Idempotency-Key | header | Stable key used to make the mutation safe to retry | Yes | string |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSBulkDocumentDeletePayload](#knowledgefsbulkdocumentdeletepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS document deletions accepted | **application/json**: [KnowledgeFSBulkDeletionAcceptedResponse](#knowledgefsbulkdeletionacceptedresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/documents/reindex
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSDocumentReindexPayload](#knowledgefsdocumentreindexpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS document reindex queued | **application/json**: [KnowledgeFSDocumentReindexResponse](#knowledgefsdocumentreindexresponse)<br> |
|
|
|
|
### [DELETE] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| Idempotency-Key | header | Stable key used to make the mutation safe to retry | Yes | string |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSDocumentDeletePayload](#knowledgefsdocumentdeletepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS document deletion accepted | **application/json**: [KnowledgeFSDurableDeletionAcceptedResponse](#knowledgefsdurabledeletionacceptedresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS document | **application/json**: [KnowledgeFSDocumentResponse](#knowledgefsdocumentresponse)<br> |
|
|
|
|
### [PATCH] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSDocumentMetadataPayload](#knowledgefsdocumentmetadatapayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS document metadata updated | **application/json**: [KnowledgeFSLogicalDocumentResponse](#knowledgefslogicaldocumentresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}/outline
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS document outline | **application/json**: [KnowledgeFSDocumentOutlineResponse](#knowledgefsdocumentoutlineresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}/revisions
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS document revisions | **application/json**: [KnowledgeFSDocumentRevisionListResponse](#knowledgefsdocumentrevisionlistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}/revisions/{revision}/chunks
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| query | query | | No | string |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
| revision | path | | Yes | integer |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS document chunks | **application/json**: [KnowledgeFSDocumentChunkListResponse](#knowledgefsdocumentchunklistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/documents/{document_id}/revisions/{revision}/chunks/{chunk_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| chunk_id | path | | Yes | string |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
| revision | path | | Yes | integer |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS document chunk | **application/json**: [KnowledgeFSDocumentChunkResponse](#knowledgefsdocumentchunkresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/external-access
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS external access | **application/json**: [KnowledgeFSExternalAccessResponse](#knowledgefsexternalaccessresponse)<br> |
|
|
|
|
### [PUT] /knowledge-fs/spaces/{control_space_id}/external-access
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSExternalAccessPayload](#knowledgefsexternalaccesspayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS external access updated | **application/json**: [KnowledgeFSExternalAccessResponse](#knowledgefsexternalaccessresponse)<br> |
|
|
|
|
### [DELETE] /knowledge-fs/spaces/{control_space_id}/jobs/{job_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| job_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS compilation job canceled | **application/json**: [KnowledgeFSDocumentCompilationJobResponse](#knowledgefsdocumentcompilationjobresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/jobs/{job_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| job_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS compilation job | **application/json**: [KnowledgeFSDocumentCompilationJobResponse](#knowledgefsdocumentcompilationjobresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/jobs/{job_id}/retry
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| job_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS compilation job retried | **application/json**: [KnowledgeFSDocumentCompilationJobResponse](#knowledgefsdocumentcompilationjobresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/logical-documents
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS logical documents | **application/json**: [KnowledgeFSLogicalDocumentListResponse](#knowledgefslogicaldocumentlistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/logical-documents/{document_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| document_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS logical document | **application/json**: [KnowledgeFSLogicalDocumentResponse](#knowledgefslogicaldocumentresponse)<br> |
|
|
|
|
### [PUT] /knowledge-fs/spaces/{control_space_id}/members
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSMembersReplacePayload](#knowledgefsmembersreplacepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS space members replaced | **application/json**: [KnowledgeFSPermissionListResponse](#knowledgefspermissionlistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/overview/health
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS health | **application/json**: [KnowledgeFSOverviewHealthResponse](#knowledgefsoverviewhealthresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/overview/inventory
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS inventory | **application/json**: [KnowledgeFSOverviewInventoryResponse](#knowledgefsoverviewinventoryresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/overview/query-outcomes
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| window | query | | No | string, <br>**Available values:** "24h", "30d", "7d", <br>**Default:** 24h |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS query outcomes | **application/json**: [KnowledgeFSOverviewQueryOutcomesResponse](#knowledgefsoverviewqueryoutcomesresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/overview/stats
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| window | query | | No | string, <br>**Available values:** "24h", "30d", "7d", <br>**Default:** 24h |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS Overview statistics | **application/json**: [KnowledgeFSOverviewStatsResponse](#knowledgefsoverviewstatsresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/permissions
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS space permissions | **application/json**: [KnowledgeFSPermissionListResponse](#knowledgefspermissionlistresponse)<br> |
|
|
|
|
### ~~[POST] /knowledge-fs/spaces/{control_space_id}/queries~~
|
|
|
|
***DEPRECATED***
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSQueryCreatePayload](#knowledgefsquerycreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS query accepted | **application/json**: [KnowledgeFSQueryResponse](#knowledgefsqueryresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/queries/admission
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSQueryCreatePayload](#knowledgefsquerycreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS direct query admitted | **application/json**: [KnowledgeFSQueryAdmissionResponse](#knowledgefsqueryadmissionresponse)<br> |
|
|
|
|
### ~~[POST] /knowledge-fs/spaces/{control_space_id}/query-stream-capability~~
|
|
|
|
***DEPRECATED***
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS query stream capability | **application/json**: [KnowledgeFSQueryStreamCapabilityResponse](#knowledgefsquerystreamcapabilityresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/research-tasks
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS research tasks | **application/json**: [KnowledgeFSResearchTaskListResponse](#knowledgefsresearchtasklistresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/research-tasks
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSResearchTaskCreatePayload](#knowledgefsresearchtaskcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS research task accepted | **application/json**: [KnowledgeFSResearchTaskResponse](#knowledgefsresearchtaskresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/research-tasks/plan
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSResearchTaskPlanPayload](#knowledgefsresearchtaskplanpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS research task plan | **application/json**: [KnowledgeFSResearchTaskPlanResponse](#knowledgefsresearchtaskplanresponse)<br> |
|
|
|
|
### [DELETE] /knowledge-fs/spaces/{control_space_id}/research-tasks/{task_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS research task canceled | **application/json**: [KnowledgeFSResearchTaskResponse](#knowledgefsresearchtaskresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/research-tasks/{task_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS research task | **application/json**: [KnowledgeFSResearchTaskResponse](#knowledgefsresearchtaskresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/research-tasks/{task_id}/partials
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 25 |
|
|
| control_space_id | path | | Yes | string |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS research task partial evidence | **application/json**: [KnowledgeFSResearchTaskPartialListResponse](#knowledgefsresearchtaskpartiallistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/settings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS settings | **application/json**: [KnowledgeFSSettingsResponse](#knowledgefssettingsresponse)<br> |
|
|
|
|
### [PATCH] /knowledge-fs/spaces/{control_space_id}/settings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSettingsPayload](#knowledgefssettingspayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS settings updated | **application/json**: [KnowledgeFSSettingsResponse](#knowledgefssettingsresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/source-connections
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 50 |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source connections | **application/json**: [KnowledgeFSSourceConnectionListResponse](#knowledgefssourceconnectionlistresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/source-connections
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceConnectionCreatePayload](#knowledgefssourceconnectioncreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | KnowledgeFS source connection created | **application/json**: [KnowledgeFSSourceConnectionResponse](#knowledgefssourceconnectionresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/source-connections/{connection_id}/refresh
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| connection_id | path | | Yes | string |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceConnectionRefreshPayload](#knowledgefssourceconnectionrefreshpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source connection refreshed | **application/json**: [KnowledgeFSSourceConnectionResponse](#knowledgefssourceconnectionresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/source-providers
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source providers | **application/json**: [KnowledgeFSSourceProviderListResponse](#knowledgefssourceproviderlistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/source-workflows/{run_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| run_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source workflow | **application/json**: [KnowledgeFSSourceWorkflowResponse](#knowledgefssourceworkflowresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/source-workflows/{run_id}/cancel
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| run_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceWorkflowCancelPayload](#knowledgefssourceworkflowcancelpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source workflow canceled | **application/json**: [KnowledgeFSSourceWorkflowResponse](#knowledgefssourceworkflowresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/source-workflows/{run_id}/pages
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 50 |
|
|
| control_space_id | path | | Yes | string |
|
|
| run_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS crawl preview pages | **application/json**: [KnowledgeFSCrawlPreviewPageListResponse](#knowledgefscrawlpreviewpagelistresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/source-workflows/{run_id}/retry
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| run_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source workflow retried | **application/json**: [KnowledgeFSSourceWorkflowResponse](#knowledgefssourceworkflowresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/source-workflows/{run_id}/selection
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| Idempotency-Key | header | Stable key used to make the mutation safe to retry | Yes | string |
|
|
| control_space_id | path | | Yes | string |
|
|
| run_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSCrawlPreviewSelectionPayload](#knowledgefscrawlpreviewselectionpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS crawl preview selection accepted | **application/json**: [KnowledgeFSSourceWorkflowResponse](#knowledgefssourceworkflowresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/sources
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 50 |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS sources | **application/json**: [KnowledgeFSSourceListResponse](#knowledgefssourcelistresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/sources
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceCreatePayload](#knowledgefssourcecreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | KnowledgeFS source created | **application/json**: [KnowledgeFSSourceResponse](#knowledgefssourceresponse)<br> |
|
|
|
|
### [DELETE] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| Idempotency-Key | header | Stable key used to make the mutation safe to retry | Yes | string |
|
|
| documents | query | | No | string, <br>**Available values:** "cascade", "keep", <br>**Default:** cascade |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceDeletePayload](#knowledgefssourcedeletepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS source deletion accepted | **application/json**: [KnowledgeFSDurableDeletionAcceptedResponse](#knowledgefsdurabledeletionacceptedresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source | **application/json**: [KnowledgeFSSourceResponse](#knowledgefssourceresponse)<br> |
|
|
|
|
### [PATCH] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceUpdatePayload](#knowledgefssourceupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source updated | **application/json**: [KnowledgeFSSourceResponse](#knowledgefssourceresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/crawl-preview
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| Idempotency-Key | header | Stable key used to make the mutation safe to retry | Yes | string |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS source crawl preview accepted | **application/json**: [KnowledgeFSSourceWorkflowResponse](#knowledgefssourceworkflowresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/files
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| bucket | query | | No | string |
|
|
| continuationToken | query | | No | string |
|
|
| maxKeys | query | | No | integer |
|
|
| prefix | query | | No | string |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source files | **application/json**: [KnowledgeFSSourceFilesResponse](#knowledgefssourcefilesresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/import
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceImportPagesPayload](#knowledgefssourceimportpagespayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source pages imported | **application/json**: [KnowledgeFSSourceImportResponse](#knowledgefssourceimportresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/import-files
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceImportFilesPayload](#knowledgefssourceimportfilespayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source files imported | **application/json**: [KnowledgeFSSourceImportResponse](#knowledgefssourceimportresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/pages
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 50 |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source pages | **application/json**: [KnowledgeFSSourcePagesResponse](#knowledgefssourcepagesresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/sync
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| Idempotency-Key | header | Stable key used to make the mutation safe to retry | Yes | string |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS source sync accepted | **application/json**: [KnowledgeFSSourceWorkflowResponse](#knowledgefssourceworkflowresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/sync-policy
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source sync policy | **application/json**: [KnowledgeFSSourceSyncPolicyResponse](#knowledgefssourcesyncpolicyresponse)<br> |
|
|
|
|
### [PUT] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/sync-policy
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceSyncPolicyPayload](#knowledgefssourcesyncpolicypayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source sync policy updated | **application/json**: [KnowledgeFSSourceSyncPolicyResponse](#knowledgefssourcesyncpolicyresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/test
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS source credential test | **application/json**: [KnowledgeFSSourceCredentialTestResponse](#knowledgefssourcecredentialtestresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/sources/{source_id}/workflow-imports
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| Idempotency-Key | header | Stable key used to make the mutation safe to retry | Yes | string |
|
|
| control_space_id | path | | Yes | string |
|
|
| source_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSSourceWorkflowImportPayload](#knowledgefssourceworkflowimportpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | KnowledgeFS durable provider import accepted | **application/json**: [KnowledgeFSSourceWorkflowResponse](#knowledgefssourceworkflowresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/traces
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS traces | **application/json**: [KnowledgeFSTraceListResponse](#knowledgefstracelistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/traces/{trace_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| trace_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS answer trace | **application/json**: [KnowledgeFSAnswerTraceResponse](#knowledgefsanswertraceresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/traces/{trace_id}/conflicts
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 100 |
|
|
| control_space_id | path | | Yes | string |
|
|
| trace_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS trace conflicts | **application/json**: [KnowledgeFSTraceEntryListResponse](#knowledgefstraceentrylistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/traces/{trace_id}/evidence
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 100 |
|
|
| control_space_id | path | | Yes | string |
|
|
| trace_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS trace evidence view | **application/json**: [KnowledgeFSTraceEntryListResponse](#knowledgefstraceentrylistresponse)<br> |
|
|
|
|
### [GET] /knowledge-fs/spaces/{control_space_id}/traces/{trace_id}/missing
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| cursor | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 100 |
|
|
| control_space_id | path | | Yes | string |
|
|
| trace_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS trace missing evidence | **application/json**: [KnowledgeFSTraceEntryListResponse](#knowledgefstraceentrylistresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/upload-capabilities
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSUploadCapabilityPayload](#knowledgefsuploadcapabilitypayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS upload capability | **application/json**: [KnowledgeFSCapabilityResponse](#knowledgefscapabilityresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/spaces/{control_space_id}/upload-sessions/{upload_session_id}/small-file
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| control_space_id | path | | Yes | string |
|
|
| upload_session_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS small-file fallback completed | **application/json**: [KnowledgeFSSmallFileUploadResponse](#knowledgefssmallfileuploadresponse)<br> |
|
|
|
|
### [POST] /knowledge-fs/tasks/{task_id}/stream-capability
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [KnowledgeFSStreamCapabilityPayload](#knowledgefsstreamcapabilitypayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | KnowledgeFS task stream capability | **application/json**: [KnowledgeFSStreamCapabilityResponse](#knowledgefsstreamcapabilityresponse)<br> |
|
|
|
|
### [POST] /login
|
|
**Authenticate user and login**
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [LoginPayload](#loginpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultOptionalDataResponse](#simpleresultoptionaldataresponse)<br> |
|
|
|
|
### [POST] /logout
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /mcp/oauth/callback
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| code | query | | Yes | string |
|
|
| state | query | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 302 | Redirect to OAuth callback page |
|
|
|
|
### [GET] /notification
|
|
Return the active in-product notification for the current user in their interface language (falls back to English if unavailable). The notification is NOT marked as seen here; call POST /notification/dismiss when the user explicitly closes the modal.
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success — inspect should_show to decide whether to render the modal | **application/json**: [NotificationResponse](#notificationresponse)<br> |
|
|
| 401 | Unauthorized | |
|
|
|
|
### [POST] /notification/dismiss
|
|
Mark a notification as dismissed for the current user.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DismissNotificationPayload](#dismissnotificationpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 401 | Unauthorized | |
|
|
|
|
### [GET] /notion/pages/{page_id}/{page_type}/preview
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| credential_id | query | Credential ID | Yes | string |
|
|
| page_id | path | | Yes | string (uuid) |
|
|
| page_type | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [TextContentResponse](#textcontentresponse)<br> |
|
|
|
|
### [GET] /notion/pre-import/pages
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| credential_id | query | Credential ID | Yes | string |
|
|
| dataset_id | query | Dataset ID | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [NotionIntegrateInfoListResponse](#notionintegrateinfolistresponse)<br> |
|
|
|
|
### [GET] /oauth/authorize/{provider}
|
|
Handle OAuth callback and complete login process
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | OAuth provider name (github/google) | Yes | string |
|
|
| code | query | Authorization code from OAuth provider | Yes | string |
|
|
| state | query | OAuth state parameter | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 302 | Redirect to console with access token | **application/json**: [RedirectResponse](#redirectresponse)<br> |
|
|
| 400 | OAuth process failed | |
|
|
|
|
### [GET] /oauth/data-source/binding/{provider}
|
|
Bind OAuth data source with authorization code
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | Data source provider name (notion) | Yes | string |
|
|
| code | query | Authorization code from OAuth provider | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Data source binding success | **application/json**: [OAuthDataSourceBindingResponse](#oauthdatasourcebindingresponse)<br> |
|
|
| 400 | Invalid provider or code | |
|
|
|
|
### [GET] /oauth/data-source/callback/{provider}
|
|
Handle OAuth callback from data source provider
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | Data source provider name (notion) | Yes | string |
|
|
| code | query | Authorization code from OAuth provider | No | string |
|
|
| error | query | Error message from OAuth provider | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 302 | Redirect to console with result | **application/json**: [RedirectResponse](#redirectresponse)<br> |
|
|
| 400 | Invalid provider | |
|
|
|
|
### [GET] /oauth/data-source/{provider}
|
|
Get OAuth authorization URL for data source provider
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | Data source provider name (notion) | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Authorization URL or internal setup success | **application/json**: [OAuthDataSourceResponse](#oauthdatasourceresponse)<br> |
|
|
| 400 | Invalid provider | |
|
|
| 403 | Admin privileges required | |
|
|
|
|
### [GET] /oauth/data-source/{provider}/{binding_id}/sync
|
|
Sync data from OAuth data source
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| binding_id | path | Data source binding ID | Yes | string (uuid) |
|
|
| provider | path | Data source provider name (notion) | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Data source sync success | **application/json**: [OAuthDataSourceSyncResponse](#oauthdatasourcesyncresponse)<br> |
|
|
| 400 | Invalid provider or sync failed | |
|
|
|
|
### [GET] /oauth/login/{provider}
|
|
Initiate OAuth login process
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | OAuth provider name (github/google) | Yes | string |
|
|
| invite_token | query | Optional invitation token | No | string |
|
|
| language | query | Preferred interface language | No | string |
|
|
| redirect_url | query | Relative page to resume after login | No | string |
|
|
| timezone | query | Preferred timezone | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 302 | Redirect to OAuth authorization URL | **application/json**: [RedirectResponse](#redirectresponse)<br> |
|
|
| 400 | Invalid provider | |
|
|
|
|
### [GET] /oauth/plugin/{provider_id}/datasource/callback
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| code | query | Authorization code from OAuth provider | No | string |
|
|
| context_id | query | OAuth proxy context ID | No | string |
|
|
| error | query | Error message from OAuth provider | No | string |
|
|
| state | query | OAuth state parameter | No | string |
|
|
| provider_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 302 | Redirect to OAuth callback page |
|
|
|
|
### [GET] /oauth/plugin/{provider_id}/datasource/get-authorization-url
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| credential_id | query | Credential ID to reauthorize | No | string |
|
|
| provider_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Datasource OAuth authorization URL generated successfully | **application/json**: [PluginOAuthAuthorizationUrlResponse](#pluginoauthauthorizationurlresponse)<br> |
|
|
|
|
### [GET] /oauth/plugin/{provider}/tool/authorization-url
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Tool OAuth authorization URL generated successfully | **application/json**: [PluginOAuthAuthorizationUrlResponse](#pluginoauthauthorizationurlresponse)<br> |
|
|
|
|
### [GET] /oauth/plugin/{provider}/tool/callback
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 302 | Redirect to OAuth callback page |
|
|
|
|
### [GET] /oauth/plugin/{provider}/trigger/callback
|
|
**Handle OAuth callback for trigger provider**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 302 | Redirect to OAuth callback page |
|
|
|
|
### [POST] /oauth/provider
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [OAuthProviderRequest](#oauthproviderrequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [OAuthProviderAppResponse](#oauthproviderappresponse)<br> |
|
|
|
|
### [POST] /oauth/provider/account
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [OAuthClientPayload](#oauthclientpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [OAuthProviderAccountResponse](#oauthprovideraccountresponse)<br> |
|
|
|
|
### [POST] /oauth/provider/authorize
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [OAuthClientPayload](#oauthclientpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [OAuthProviderAuthorizeResponse](#oauthproviderauthorizeresponse)<br> |
|
|
|
|
### [POST] /oauth/provider/token
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [OAuthTokenRequest](#oauthtokenrequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [OAuthProviderTokenResponse](#oauthprovidertokenresponse)<br> |
|
|
|
|
### [GET] /onboarding/step-by-step-tour/state
|
|
Get account-level Step-by-step Tour state
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [StepByStepTourStateResponse](#stepbysteptourstateresponse)<br> |
|
|
|
|
### [PATCH] /onboarding/step-by-step-tour/state
|
|
Update account-level Step-by-step Tour state
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [StepByStepTourStatePatchPayload](#stepbysteptourstatepatchpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [StepByStepTourStateResponse](#stepbysteptourstateresponse)<br> |
|
|
|
|
### [DELETE] /rag/pipeline/customized/templates/{template_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| template_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Pipeline template deleted |
|
|
|
|
### [PATCH] /rag/pipeline/customized/templates/{template_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| template_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [CustomizedPipelineTemplatePayload](#customizedpipelinetemplatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Pipeline template updated |
|
|
|
|
### [POST] /rag/pipeline/customized/templates/{template_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| template_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleDataResponse](#simpledataresponse)<br> |
|
|
|
|
### [POST] /rag/pipeline/dataset
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [RagPipelineDatasetImportPayload](#ragpipelinedatasetimportpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | RAG pipeline dataset import started | **application/json**: [RagPipelineImportResponse](#ragpipelineimportresponse)<br> |
|
|
|
|
### [POST] /rag/pipeline/empty-dataset
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | RAG pipeline dataset created | **application/json**: [DatasetDetailResponse](#datasetdetailresponse)<br> |
|
|
|
|
### [GET] /rag/pipeline/templates
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| language | query | Template language | No | string, <br>**Default:** en-US |
|
|
| type | query | Template source: built-in or customized | No | string, <br>**Default:** built-in |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Pipeline templates | **application/json**: [PipelineTemplateListResponse](#pipelinetemplatelistresponse)<br> |
|
|
|
|
### [GET] /rag/pipeline/templates/{template_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| type | query | Template source: built-in or customized | No | string, <br>**Default:** built-in |
|
|
| template_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Pipeline template | **application/json**: [PipelineTemplateDetailResponse](#pipelinetemplatedetailresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/datasource-plugins
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineOpaqueResponse](#ragpipelineopaqueresponse)<br> |
|
|
|
|
### [POST] /rag/pipelines/imports
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [RagPipelineImportPayload](#ragpipelineimportpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Import completed | **application/json**: [RagPipelineImportResponse](#ragpipelineimportresponse)<br> |
|
|
| 202 | Import pending confirmation | **application/json**: [RagPipelineImportResponse](#ragpipelineimportresponse)<br> |
|
|
| 400 | Import failed | **application/json**: [RagPipelineImportResponse](#ragpipelineimportresponse)<br> |
|
|
|
|
### [POST] /rag/pipelines/imports/{import_id}/confirm
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| import_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Import confirmed | **application/json**: [RagPipelineImportResponse](#ragpipelineimportresponse)<br> |
|
|
| 400 | Import failed | **application/json**: [RagPipelineImportResponse](#ragpipelineimportresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/imports/{pipeline_id}/check-dependencies
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Dependencies checked | **application/json**: [RagPipelineImportCheckDependenciesResponse](#ragpipelineimportcheckdependenciesresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/recommended-plugins
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| type | query | | No | string, <br>**Default:** all |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineOpaqueResponse](#ragpipelineopaqueresponse)<br> |
|
|
|
|
### [POST] /rag/pipelines/transform/datasets/{dataset_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineOpaqueResponse](#ragpipelineopaqueresponse)<br> |
|
|
|
|
### [POST] /rag/pipelines/{pipeline_id}/customized/publish
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [CustomizedPipelineTemplatePayload](#customizedpipelinetemplatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Pipeline template published |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/exports
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| include_secret | query | Whether to include secret values in the exported DSL | No | string, <br>**Default:** false |
|
|
| pipeline_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Pipeline exported | **application/json**: [SimpleDataResponse](#simpledataresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflow-runs
|
|
**Get workflow run list**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| last_id | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 20 |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow runs retrieved successfully | **application/json**: [WorkflowRunPaginationResponse](#workflowrunpaginationresponse)<br> |
|
|
|
|
### [POST] /rag/pipelines/{pipeline_id}/workflow-runs/tasks/{task_id}/stop
|
|
**Stop workflow task**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Task stopped successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflow-runs/{run_id}
|
|
**Get workflow run detail**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
| run_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow run detail retrieved successfully | **application/json**: [WorkflowRunDetailResponse](#workflowrundetailresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflow-runs/{run_id}/node-executions
|
|
**Get workflow run node execution list**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
| run_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Node executions retrieved successfully | **application/json**: [WorkflowRunNodeExecutionListResponse](#workflowrunnodeexecutionlistresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows
|
|
**Get published workflows**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| limit | query | | No | integer, <br>**Default:** 10 |
|
|
| named_only | query | | No | boolean |
|
|
| page | query | | No | integer, <br>**Default:** 1 |
|
|
| user_id | query | | No | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Published workflows retrieved successfully | **application/json**: [WorkflowPaginationResponse](#workflowpaginationresponse)<br> |
|
|
| 403 | Permission denied | |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows/default-workflow-block-configs
|
|
**Get default block config**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Default block configs retrieved successfully | **application/json**: [DefaultBlockConfigsResponse](#defaultblockconfigsresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows/default-workflow-block-configs/{block_type}
|
|
**Get default block config**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| q | query | | No | string |
|
|
| block_type | path | | Yes | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Default block config retrieved successfully | **application/json**: [DefaultBlockConfigResponse](#defaultblockconfigresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows/draft
|
|
**Get draft rag pipeline's workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Draft workflow retrieved successfully | **application/json**: [WorkflowResponse](#workflowresponse)<br> |
|
|
| 404 | Draft workflow not found | |
|
|
|
|
### [POST] /rag/pipelines/{pipeline_id}/workflows/draft
|
|
**Sync draft workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DraftWorkflowSyncPayload](#draftworkflowsyncpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineWorkflowSyncResponse](#ragpipelineworkflowsyncresponse)<br> |
|
|
|
|
### [POST] /rag/pipelines/{pipeline_id}/workflows/draft/datasource/nodes/{node_id}/run
|
|
**Run rag pipeline datasource**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DatasourceNodeRunPayload](#datasourcenoderunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineOpaqueResponse](#ragpipelineopaqueresponse)<br> |
|
|
|
|
### [POST] /rag/pipelines/{pipeline_id}/workflows/draft/datasource/variables-inspect
|
|
**Set datasource variables**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DatasourceVariablesPayload](#datasourcevariablespayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Datasource variables set successfully | **application/json**: [WorkflowRunNodeExecutionResponse](#workflowrunnodeexecutionresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows/draft/environment-variables
|
|
**Get draft workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Environment variables retrieved successfully | **application/json**: [EnvironmentVariableListResponse](#environmentvariablelistresponse)<br> |
|
|
|
|
### [POST] /rag/pipelines/{pipeline_id}/workflows/draft/iteration/nodes/{node_id}/run
|
|
**Run draft workflow iteration node**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [NodeRunPayload](#noderunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineOpaqueResponse](#ragpipelineopaqueresponse)<br> |
|
|
|
|
### [POST] /rag/pipelines/{pipeline_id}/workflows/draft/loop/nodes/{node_id}/run
|
|
**Run draft workflow loop node**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [NodeRunPayload](#noderunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineOpaqueResponse](#ragpipelineopaqueresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows/draft/nodes/{node_id}/last-run
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Node last run retrieved successfully | **application/json**: [WorkflowRunNodeExecutionResponse](#workflowrunnodeexecutionresponse)<br> |
|
|
|
|
### [POST] /rag/pipelines/{pipeline_id}/workflows/draft/nodes/{node_id}/run
|
|
**Run draft workflow node**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [NodeRunRequiredPayload](#noderunrequiredpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Node run started successfully | **application/json**: [WorkflowRunNodeExecutionResponse](#workflowrunnodeexecutionresponse)<br> |
|
|
|
|
### [DELETE] /rag/pipelines/{pipeline_id}/workflows/draft/nodes/{node_id}/variables
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Node variables deleted successfully |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows/draft/nodes/{node_id}/variables
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Node variables retrieved successfully | **application/json**: [WorkflowDraftVariableList](#workflowdraftvariablelist)<br> |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows/draft/pre-processing/parameters
|
|
**Get first step parameters of rag pipeline**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | query | | Yes | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineStepParametersResponse](#ragpipelinestepparametersresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows/draft/processing/parameters
|
|
**Get second step parameters of rag pipeline**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | query | | Yes | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineStepParametersResponse](#ragpipelinestepparametersresponse)<br> |
|
|
|
|
### [POST] /rag/pipelines/{pipeline_id}/workflows/draft/run
|
|
**Run draft workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DraftWorkflowRunPayload](#draftworkflowrunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineOpaqueResponse](#ragpipelineopaqueresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows/draft/system-variables
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | System variables retrieved successfully | **application/json**: [WorkflowDraftVariableList](#workflowdraftvariablelist)<br> |
|
|
|
|
### [DELETE] /rag/pipelines/{pipeline_id}/workflows/draft/variables
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Workflow variables deleted successfully |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows/draft/variables
|
|
**Get draft workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| limit | query | | No | integer, <br>**Default:** 20 |
|
|
| page | query | | No | integer, <br>**Default:** 1 |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow variables retrieved successfully | **application/json**: [WorkflowDraftVariableListWithoutValue](#workflowdraftvariablelistwithoutvalue)<br> |
|
|
|
|
### [DELETE] /rag/pipelines/{pipeline_id}/workflows/draft/variables/{variable_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
| variable_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Variable deleted successfully |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows/draft/variables/{variable_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
| variable_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Variable retrieved successfully | **application/json**: [WorkflowDraftVariable](#workflowdraftvariable)<br> |
|
|
|
|
### [PATCH] /rag/pipelines/{pipeline_id}/workflows/draft/variables/{variable_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
| variable_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowDraftVariablePatchPayload](#workflowdraftvariablepatchpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Variable updated successfully | **application/json**: [WorkflowDraftVariable](#workflowdraftvariable)<br> |
|
|
|
|
### [PUT] /rag/pipelines/{pipeline_id}/workflows/draft/variables/{variable_id}/reset
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
| variable_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Variable reset successfully | **application/json**: [WorkflowDraftVariable](#workflowdraftvariable)<br> |
|
|
| 204 | Variable reset (no content) | |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows/publish
|
|
**Get published pipeline**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Published workflow retrieved successfully, or null if not exist | **application/json**: [WorkflowResponse](#workflowresponse)<br> |
|
|
|
|
### [POST] /rag/pipelines/{pipeline_id}/workflows/publish
|
|
**Publish workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineWorkflowPublishResponse](#ragpipelineworkflowpublishresponse)<br> |
|
|
|
|
### [POST] /rag/pipelines/{pipeline_id}/workflows/published/datasource/nodes/{node_id}/preview
|
|
**Run datasource content preview**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [Parser](#parser)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Success |
|
|
|
|
### [POST] /rag/pipelines/{pipeline_id}/workflows/published/datasource/nodes/{node_id}/run
|
|
**Run rag pipeline datasource**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [DatasourceNodeRunPayload](#datasourcenoderunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineOpaqueResponse](#ragpipelineopaqueresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows/published/pre-processing/parameters
|
|
**Get first step parameters of rag pipeline**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | query | | Yes | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineStepParametersResponse](#ragpipelinestepparametersresponse)<br> |
|
|
|
|
### [GET] /rag/pipelines/{pipeline_id}/workflows/published/processing/parameters
|
|
**Get second step parameters of rag pipeline**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | query | | Yes | string |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineStepParametersResponse](#ragpipelinestepparametersresponse)<br> |
|
|
|
|
### [POST] /rag/pipelines/{pipeline_id}/workflows/published/run
|
|
**Run published workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [PublishedWorkflowRunPayload](#publishedworkflowrunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineOpaqueResponse](#ragpipelineopaqueresponse)<br> |
|
|
|
|
### [DELETE] /rag/pipelines/{pipeline_id}/workflows/{workflow_id}
|
|
**Delete a published workflow version that is not currently active on the pipeline**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
| workflow_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Workflow deleted successfully |
|
|
|
|
### [PATCH] /rag/pipelines/{pipeline_id}/workflows/{workflow_id}
|
|
**Update workflow attributes**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
| workflow_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowUpdatePayload](#workflowupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow updated successfully | **application/json**: [WorkflowResponse](#workflowresponse)<br> |
|
|
| 400 | No valid fields to update | |
|
|
| 403 | Permission denied | |
|
|
| 404 | Workflow not found | |
|
|
|
|
### [POST] /rag/pipelines/{pipeline_id}/workflows/{workflow_id}/restore
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| pipeline_id | path | | Yes | string (uuid) |
|
|
| workflow_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RagPipelineWorkflowSyncResponse](#ragpipelineworkflowsyncresponse)<br> |
|
|
|
|
### [POST] /refresh-token
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 401 | Unauthorized | **application/json**: [SimpleResultMessageResponse](#simpleresultmessageresponse)<br> |
|
|
|
|
### [POST] /remote-files/upload
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [RemoteFileUploadPayload](#remotefileuploadpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | File uploaded successfully | **application/json**: [FileWithSignedUrl](#filewithsignedurl)<br> |
|
|
|
|
### [GET] /remote-files/{url}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| url | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RemoteFileInfo](#remotefileinfo)<br> |
|
|
|
|
### [POST] /reset-password
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [EmailPayload](#emailpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultDataResponse](#simpleresultdataresponse)<br> |
|
|
|
|
### [POST] /rule-code-generate
|
|
Generate code rules using LLM
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [RuleCodeGeneratePayload](#rulecodegeneratepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Code rules generated successfully | **application/json**: [GeneratorResponse](#generatorresponse)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
| 402 | Provider quota exceeded | |
|
|
|
|
### [POST] /rule-generate
|
|
Generate rule configuration using LLM
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [RuleGeneratePayload](#rulegeneratepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Rule configuration generated successfully | **application/json**: [GeneratorResponse](#generatorresponse)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
| 402 | Provider quota exceeded | |
|
|
|
|
### [POST] /rule-structured-output-generate
|
|
Generate structured output rules using LLM
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [RuleStructuredOutputPayload](#rulestructuredoutputpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Structured output generated successfully | **application/json**: [GeneratorResponse](#generatorresponse)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
| 402 | Provider quota exceeded | |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflow-runs
|
|
**List workflow runs for snippet**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| last_id | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 20 |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow runs retrieved successfully | **application/json**: [WorkflowRunPaginationResponse](#workflowrunpaginationresponse)<br> |
|
|
|
|
### [POST] /snippets/{snippet_id}/workflow-runs/tasks/{task_id}/stop
|
|
**Stop a running snippet workflow task**
|
|
|
|
Uses both the legacy stop flag mechanism and the graph engine
|
|
command channel for backward compatibility.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Task stopped successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
| 404 | Snippet not found | |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflow-runs/{run_id}
|
|
**Get workflow run detail for snippet**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| run_id | path | | Yes | string (uuid) |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow run detail retrieved successfully | **application/json**: [WorkflowRunDetailResponse](#workflowrundetailresponse)<br> |
|
|
| 404 | Workflow run not found | |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflow-runs/{run_id}/node-executions
|
|
**List node executions for a workflow run**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| run_id | path | | Yes | string (uuid) |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Node executions retrieved successfully | **application/json**: [WorkflowRunNodeExecutionListResponse](#workflowrunnodeexecutionlistresponse)<br> |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflows
|
|
**Get all published workflow versions for snippet**
|
|
|
|
Get all published workflows for a snippet
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | Snippet ID | Yes | string (uuid) |
|
|
| limit | query | | No | integer, <br>**Default:** 10 |
|
|
| page | query | | No | integer, <br>**Default:** 1 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Published workflows retrieved successfully | **application/json**: [SnippetWorkflowPaginationResponse](#snippetworkflowpaginationresponse)<br> |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflows/default-workflow-block-configs
|
|
**Get default block configurations for snippet workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Default block configs retrieved successfully | **application/json**: [DefaultBlockConfigsResponse](#defaultblockconfigsresponse)<br> |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflows/draft
|
|
**Get draft workflow for snippet**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Draft workflow retrieved successfully | **application/json**: [SnippetWorkflowResponse](#snippetworkflowresponse)<br> |
|
|
| 404 | Snippet or draft workflow not found | |
|
|
|
|
### [POST] /snippets/{snippet_id}/workflows/draft
|
|
**Sync draft workflow for snippet**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [SnippetDraftSyncPayload](#snippetdraftsyncpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Draft workflow synced successfully | **application/json**: [WorkflowRestoreResponse](#workflowrestoreresponse)<br> |
|
|
| 400 | Hash mismatch | |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflows/draft/config
|
|
**Get snippet draft workflow configuration limits**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Draft config retrieved successfully | **application/json**: [SnippetDraftConfigResponse](#snippetdraftconfigresponse)<br> |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflows/draft/conversation-variables
|
|
Conversation variables are not used in snippet workflows; returns an empty list for API parity
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Conversation variables retrieved successfully | **application/json**: [WorkflowDraftVariableList](#workflowdraftvariablelist)<br> |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflows/draft/environment-variables
|
|
Get environment variables from snippet draft workflow graph
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Environment variables retrieved successfully | **application/json**: [EnvironmentVariableListResponse](#environmentvariablelistresponse)<br> |
|
|
| 404 | Draft workflow not found | |
|
|
|
|
### [POST] /snippets/{snippet_id}/workflows/draft/iteration/nodes/{node_id}/run
|
|
**Run a draft workflow iteration node for snippet**
|
|
|
|
Run draft workflow iteration node for snippet
|
|
Iteration nodes execute their internal sub-graph multiple times over an input list.
|
|
Returns an SSE event stream with iteration progress and results.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | Node ID | Yes | string |
|
|
| snippet_id | path | Snippet ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [SnippetIterationNodeRunPayload](#snippetiterationnoderunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Iteration node run started successfully (SSE stream) | **application/json**: [GeneratedAppResponse](#generatedappresponse)<br> |
|
|
| 404 | Snippet or draft workflow not found | |
|
|
|
|
### [POST] /snippets/{snippet_id}/workflows/draft/loop/nodes/{node_id}/run
|
|
**Run a draft workflow loop node for snippet**
|
|
|
|
Run draft workflow loop node for snippet
|
|
Loop nodes execute their internal sub-graph repeatedly until a condition is met.
|
|
Returns an SSE event stream with loop progress and results.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | Node ID | Yes | string |
|
|
| snippet_id | path | Snippet ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [SnippetLoopNodeRunPayload](#snippetloopnoderunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Loop node run started successfully (SSE stream) | **application/json**: [GeneratedAppResponse](#generatedappresponse)<br> |
|
|
| 404 | Snippet or draft workflow not found | |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflows/draft/nodes/{node_id}/agent-composer
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snapshot_id | query | | No | string |
|
|
| node_id | path | | Yes | string |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Snippet agent composer state | **application/json**: [WorkflowAgentComposerResponse](#workflowagentcomposerresponse)<br> |
|
|
|
|
### [PUT] /snippets/{snippet_id}/workflows/draft/nodes/{node_id}/agent-composer
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ComposerSavePayload](#composersavepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Snippet agent composer saved | **application/json**: [WorkflowAgentComposerResponse](#workflowagentcomposerresponse)<br> |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflows/draft/nodes/{node_id}/agent-composer/candidates
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Snippet agent composer candidates | **application/json**: [AgentComposerCandidatesResponse](#agentcomposercandidatesresponse)<br> |
|
|
|
|
### [POST] /snippets/{snippet_id}/workflows/draft/nodes/{node_id}/agent-composer/copy-from-roster
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowComposerCopyFromRosterPayload](#workflowcomposercopyfromrosterpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Roster agent copied into snippet | **application/json**: [WorkflowAgentComposerResponse](#workflowagentcomposerresponse)<br> |
|
|
|
|
### [POST] /snippets/{snippet_id}/workflows/draft/nodes/{node_id}/agent-composer/impact
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ComposerSavePayload](#composersavepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Snippet agent composer impact | **application/json**: [AgentComposerImpactResponse](#agentcomposerimpactresponse)<br> |
|
|
|
|
### [POST] /snippets/{snippet_id}/workflows/draft/nodes/{node_id}/agent-composer/save-to-roster
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ComposerSavePayload](#composersavepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Snippet agent saved to roster | **application/json**: [WorkflowAgentComposerResponse](#workflowagentcomposerresponse)<br> |
|
|
|
|
### [POST] /snippets/{snippet_id}/workflows/draft/nodes/{node_id}/agent-composer/validate
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ComposerSavePayload](#composersavepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Snippet agent composer validation | **application/json**: [AgentComposerValidateResponse](#agentcomposervalidateresponse)<br> |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflows/draft/nodes/{node_id}/last-run
|
|
**Get the last run result for a specific node in snippet draft workflow**
|
|
|
|
Get last run result for a node in snippet draft workflow
|
|
Returns the most recent execution record for the given node,
|
|
including status, inputs, outputs, and timing information.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | Node ID | Yes | string |
|
|
| snippet_id | path | Snippet ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Node last run retrieved successfully | **application/json**: [WorkflowRunNodeExecutionResponse](#workflowrunnodeexecutionresponse)<br> |
|
|
| 404 | Snippet, draft workflow, or node last run not found | |
|
|
|
|
### [POST] /snippets/{snippet_id}/workflows/draft/nodes/{node_id}/run
|
|
**Run a single node in snippet draft workflow**
|
|
|
|
Run a single node in snippet draft workflow (single-step debugging)
|
|
Executes a specific node with provided inputs for single-step debugging.
|
|
Returns the node execution result including status, outputs, and timing.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | Node ID | Yes | string |
|
|
| snippet_id | path | Snippet ID | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [SnippetDraftNodeRunPayload](#snippetdraftnoderunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Node run completed successfully | **application/json**: [WorkflowRunNodeExecutionResponse](#workflowrunnodeexecutionresponse)<br> |
|
|
| 404 | Snippet or draft workflow not found | |
|
|
|
|
### [DELETE] /snippets/{snippet_id}/workflows/draft/nodes/{node_id}/variables
|
|
Delete all variables for a specific node (snippet draft workflow)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Node variables deleted successfully |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflows/draft/nodes/{node_id}/variables
|
|
Get variables for a specific node (snippet draft workflow)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| node_id | path | | Yes | string |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Node variables retrieved successfully | **application/json**: [WorkflowDraftVariableList](#workflowdraftvariablelist)<br> |
|
|
|
|
### [POST] /snippets/{snippet_id}/workflows/draft/run
|
|
**Run draft workflow for snippet**
|
|
|
|
Executes the snippet's draft workflow with the provided inputs
|
|
and returns an SSE event stream with execution progress and results.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [SnippetDraftRunPayload](#snippetdraftrunpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Draft workflow run started successfully (SSE stream) | **application/json**: [GeneratedAppResponse](#generatedappresponse)<br> |
|
|
| 404 | Snippet or draft workflow not found | |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflows/draft/system-variables
|
|
System variables are not used in snippet workflows; returns an empty list for API parity
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | System variables retrieved successfully | **application/json**: [WorkflowDraftVariableList](#workflowdraftvariablelist)<br> |
|
|
|
|
### [DELETE] /snippets/{snippet_id}/workflows/draft/variables
|
|
Delete all draft workflow variables for the current user (snippet scope)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Workflow variables deleted successfully |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflows/draft/variables
|
|
List draft workflow variables without values (paginated, snippet scope)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| limit | query | Items per page | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number | No | integer, <br>**Default:** 1 |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow variables retrieved successfully | **application/json**: [WorkflowDraftVariableListWithoutValue](#workflowdraftvariablelistwithoutvalue)<br> |
|
|
|
|
### [DELETE] /snippets/{snippet_id}/workflows/draft/variables/{variable_id}
|
|
Delete a draft workflow variable (snippet scope)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
| variable_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Variable deleted successfully |
|
|
| 404 | Variable not found |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflows/draft/variables/{variable_id}
|
|
Get a specific draft workflow variable (snippet scope)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
| variable_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Variable retrieved successfully | **application/json**: [WorkflowDraftVariable](#workflowdraftvariable)<br> |
|
|
| 404 | Variable not found | |
|
|
|
|
### [PATCH] /snippets/{snippet_id}/workflows/draft/variables/{variable_id}
|
|
Update a draft workflow variable (snippet scope)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
| variable_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowDraftVariableUpdatePayload](#workflowdraftvariableupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Variable updated successfully | **application/json**: [WorkflowDraftVariable](#workflowdraftvariable)<br> |
|
|
| 404 | Variable not found | |
|
|
|
|
### [PUT] /snippets/{snippet_id}/workflows/draft/variables/{variable_id}/reset
|
|
Reset a draft workflow variable to its default value (snippet scope)
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
| variable_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Variable reset successfully | **application/json**: [WorkflowDraftVariable](#workflowdraftvariable)<br> |
|
|
| 204 | Variable reset (no content) | |
|
|
| 404 | Variable not found | |
|
|
|
|
### [GET] /snippets/{snippet_id}/workflows/publish
|
|
**Get published workflow for snippet**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Published workflow retrieved successfully | **application/json**: [SnippetWorkflowResponse](#snippetworkflowresponse)<br> |
|
|
| 404 | Snippet not found | |
|
|
|
|
### [POST] /snippets/{snippet_id}/workflows/publish
|
|
**Publish snippet workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [PublishWorkflowPayload](#publishworkflowpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow published successfully | **application/json**: [WorkflowPublishResponse](#workflowpublishresponse)<br> |
|
|
| 400 | No draft workflow found | |
|
|
|
|
### [PATCH] /snippets/{snippet_id}/workflows/{workflow_id}
|
|
**Update a published snippet workflow version's display metadata**
|
|
|
|
Update published snippet workflow attributes
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | Snippet ID | Yes | string (uuid) |
|
|
| workflow_id | path | Workflow ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowUpdatePayload](#workflowupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow updated successfully | **application/json**: [SnippetWorkflowResponse](#snippetworkflowresponse)<br> |
|
|
| 400 | No valid fields to update | |
|
|
| 404 | Workflow not found | |
|
|
|
|
### [POST] /snippets/{snippet_id}/workflows/{workflow_id}/restore
|
|
**Restore a published snippet workflow version into the draft workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | Snippet ID | Yes | string (uuid) |
|
|
| workflow_id | path | Published workflow ID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow restored successfully | **application/json**: [WorkflowRestoreResponse](#workflowrestoreresponse)<br> |
|
|
| 400 | Source workflow must be published | |
|
|
| 404 | Workflow not found | |
|
|
|
|
### [GET] /spec/schema-definitions
|
|
**Get system JSON Schema definitions specification**
|
|
|
|
Used for frontend component type mapping
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SchemaDefinitionsResponse](#schemadefinitionsresponse)<br> |
|
|
|
|
### [GET] /system-features
|
|
**Get the non-sensitive bootstrap snapshot exposed before authentication**
|
|
|
|
Get the non-sensitive bootstrap snapshot exposed before Console or Web authentication. This is not a general feature registry.
|
|
Authentication configuration must be available before the authentication flow can be selected.
|
|
Authenticated license detail is served separately by SystemFeatureLicenseApi.
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SystemFeatureModel](#systemfeaturemodel)<br> |
|
|
|
|
### [GET] /system-features/license
|
|
**Get full license detail (status, expiry, workspace/seat usage)**
|
|
|
|
Get license status and usage detail
|
|
Authenticated counterpart to the license *status* exposed on the public
|
|
system-features endpoint.
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [LicenseModel](#licensemodel)<br> |
|
|
|
|
### [POST] /tag-bindings
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TagBindingPayload](#tagbindingpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /tag-bindings/remove
|
|
Remove one or more tag bindings from a target.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TagBindingRemovePayload](#tagbindingremovepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /tags
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| keyword | query | Search keyword | No | string |
|
|
| type | query | Tag type filter | No | string, <br>**Available values:** "", "app", "knowledge", "snippet" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [TagListResponse](#taglistresponse)<br> |
|
|
|
|
### [POST] /tags
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TagBasePayload](#tagbasepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [TagResponse](#tagresponse)<br> |
|
|
|
|
### [DELETE] /tags/{tag_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| tag_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Tag deleted successfully |
|
|
|
|
### [PATCH] /tags/{tag_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| tag_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TagUpdateRequestPayload](#tagupdaterequestpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [TagResponse](#tagresponse)<br> |
|
|
|
|
### [POST] /test/retrieval
|
|
Bedrock retrieval test (internal use only)
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [BedrockRetrievalPayload](#bedrockretrievalpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Bedrock retrieval test completed | **application/json**: [BedrockRetrievalResponse](#bedrockretrievalresponse)<br> |
|
|
|
|
### [GET] /trial-apps/{app_id}
|
|
**Get app detail**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [TrialAppDetailResponse](#trialappdetailresponse)<br> |
|
|
|
|
### [POST] /trial-apps/{app_id}/audio-to-text
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AudioTranscriptResponse](#audiotranscriptresponse)<br> |
|
|
|
|
### [POST] /trial-apps/{app_id}/chat-messages
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ChatRequest](#chatrequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Success |
|
|
|
|
### [POST] /trial-apps/{app_id}/completion-messages
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [CompletionRequest](#completionrequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Success |
|
|
|
|
### [GET] /trial-apps/{app_id}/datasets
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| ids | query | Dataset IDs | No | [ string ] |
|
|
| limit | query | Number of items per page | No | integer, <br>**Default:** 20 |
|
|
| page | query | Page number | No | integer, <br>**Default:** 1 |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [TrialDatasetListResponse](#trialdatasetlistresponse)<br> |
|
|
|
|
### [POST] /trial-apps/{app_id}/files/upload
|
|
**Upload a file into the tenant that owns the trial app**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"file"**: binary, **"source"**: string, <br>**Available values:** "datasets" }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | File uploaded successfully | **application/json**: [FileResponse](#fileresponse)<br> |
|
|
|
|
### [GET] /trial-apps/{app_id}/messages/{message_id}/suggested-questions
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| message_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SuggestedQuestionsResponse](#suggestedquestionsresponse)<br> |
|
|
|
|
### [GET] /trial-apps/{app_id}/parameters
|
|
**Retrieve app parameters**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [Parameters](#parameters)<br> |
|
|
|
|
### [POST] /trial-apps/{app_id}/remote-files/upload
|
|
**Upload a remote file into the tenant that owns the trial app**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [RemoteFileUploadPayload](#remotefileuploadpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | File uploaded successfully | **application/json**: [FileWithSignedUrl](#filewithsignedurl)<br> |
|
|
|
|
### [GET] /trial-apps/{app_id}/site
|
|
**Retrieve app site info**
|
|
|
|
Returns the site configuration for the application including theme, icons, and text.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [Site](#site)<br> |
|
|
|
|
### [POST] /trial-apps/{app_id}/text-to-audio
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TextToSpeechRequest](#texttospeechrequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AudioBinaryResponse](#audiobinaryresponse)<br> |
|
|
|
|
### [GET] /trial-apps/{app_id}/workflows
|
|
**Get workflow detail**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [TrialWorkflowResponse](#trialworkflowresponse)<br> |
|
|
|
|
### [POST] /trial-apps/{app_id}/workflows/run
|
|
**Run workflow**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowRunRequest](#workflowrunrequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Success |
|
|
|
|
### [POST] /trial-apps/{app_id}/workflows/tasks/{task_id}/stop
|
|
**Stop workflow task**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /trial-models
|
|
**Get hosted trial model provider configuration for model-provider pages**
|
|
|
|
Get hosted trial model provider configuration
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [TrialModelsResponse](#trialmodelsresponse)<br> |
|
|
|
|
### [POST] /website/crawl
|
|
Crawl website content
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WebsiteCrawlPayload](#websitecrawlpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Website crawl initiated successfully | **application/json**: [WebsiteCrawlResponse](#websitecrawlresponse)<br> |
|
|
| 400 | Invalid crawl parameters | |
|
|
|
|
### [GET] /website/crawl/status/{job_id}
|
|
Get website crawl status
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| job_id | path | Crawl job ID | Yes | string |
|
|
| provider | query | Crawl provider (firecrawl/watercrawl/jinareader) | Yes | string, <br>**Available values:** "firecrawl", "jinareader", "watercrawl" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Crawl status retrieved successfully | **application/json**: [WebsiteCrawlResponse](#websitecrawlresponse)<br> |
|
|
| 400 | Invalid provider | |
|
|
| 404 | Crawl job not found | |
|
|
|
|
### [POST] /workflow-generate
|
|
Generate a Dify workflow graph from natural language
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowGeneratePayload](#workflowgeneratepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow graph generated successfully | **application/json**: [WorkflowGenerateResponse](#workflowgenerateresponse)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
| 402 | Provider quota exceeded | |
|
|
|
|
### [POST] /workflow-generate/stream
|
|
Stream a Dify workflow graph (plan then result) via SSE
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowGeneratePayload](#workflowgeneratepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Server-Sent Events stream; each data frame matches this plan/result event schema | **application/json**: [WorkflowGenerateStreamEventResponse](#workflowgeneratestreameventresponse)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
|
|
### [POST] /workflow-generate/suggestions
|
|
Suggest example workflow-generator instructions for the tenant
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowInstructionSuggestionsPayload](#workflowinstructionsuggestionspayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Suggestions generated successfully | **application/json**: [WorkflowInstructionSuggestionsResponse](#workflowinstructionsuggestionsresponse)<br> |
|
|
| 400 | Invalid request parameters | |
|
|
|
|
### [GET] /workflow-run-archives
|
|
List monthly workflow-run archive metadata for the current workspace
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [WorkflowRunArchiveListResponse](#workflowrunarchivelistresponse)<br> |
|
|
|
|
### [POST] /workflow-run-archives/downloads
|
|
Create or return a temporary workflow-run archive download task
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowRunArchiveDownloadPayload](#workflowrunarchivedownloadpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 202 | Download task accepted | **application/json**: [WorkflowRunArchiveDownloadTaskResponse](#workflowrunarchivedownloadtaskresponse)<br> |
|
|
|
|
### [GET] /workflow-run-archives/downloads/{download_id}
|
|
Get a temporary workflow-run archive download task
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| download_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [WorkflowRunArchiveDownloadTaskResponse](#workflowrunarchivedownloadtaskresponse)<br> |
|
|
|
|
### [GET] /workflow-run-archives/downloads/{download_id}/file
|
|
Redirect to a prepared workflow-run archive ZIP file
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| download_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 302 | Redirect to pre-signed archive storage URL | **application/json**: [RedirectResponse](#redirectresponse)<br> |
|
|
| 409 | Download task is not ready | |
|
|
|
|
### [GET] /workflow/{workflow_run_id}/events
|
|
**Get workflow execution events stream after resume**
|
|
|
|
GET /console/api/workflow/<workflow_run_id>/events
|
|
|
|
Returns Server-Sent Events stream.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| workflow_run_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | SSE event stream | **application/json**: [EventStreamResponse](#eventstreamresponse)<br> |
|
|
|
|
### [GET] /workflow/{workflow_run_id}/pause-details
|
|
**Get workflow pause details**
|
|
|
|
Get workflow pause details
|
|
GET /console/api/workflow/<workflow_run_id>/pause-details
|
|
|
|
Returns information about why and where the workflow is paused.
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| workflow_run_id | path | Workflow run ID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow pause details retrieved successfully | **application/json**: [WorkflowPauseDetailsResponse](#workflowpausedetailsresponse)<br> |
|
|
| 404 | Workflow run not found | |
|
|
|
|
### [GET] /workspaces
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [TenantListResponse](#tenantlistresponse)<br> |
|
|
|
|
### [POST] /workspaces/current
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [TenantInfoResponse](#tenantinforesponse)<br> |
|
|
|
|
### [GET] /workspaces/current/agent-provider/{provider_name}
|
|
Get specific agent provider details
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider_name | path | Agent provider name | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AgentProviderResponse](#agentproviderresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/agent-providers
|
|
Get list of available agent providers
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AgentProviderListResponse](#agentproviderlistresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/customized-snippets
|
|
**List customized snippets with pagination and search**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| creators | query | Filter by creator account IDs | No | [ string ] |
|
|
| is_published | query | Filter by published status | No | boolean |
|
|
| keyword | query | | No | string |
|
|
| limit | query | | No | integer, <br>**Default:** 20 |
|
|
| page | query | | No | integer, <br>**Default:** 1 |
|
|
| tag_ids | query | Filter by tag IDs | No | [ string ] |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Snippets retrieved successfully | **application/json**: [SnippetPaginationResponse](#snippetpaginationresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/customized-snippets
|
|
**Create a new customized snippet**
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [CreateSnippetPayload](#createsnippetpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Snippet created successfully | **application/json**: [SnippetResponse](#snippetresponse)<br> |
|
|
| 400 | Invalid request | |
|
|
|
|
### [POST] /workspaces/current/customized-snippets/imports
|
|
**Import snippet from DSL**
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [SnippetImportPayload](#snippetimportpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Snippet imported successfully | **application/json**: [SnippetImportResponse](#snippetimportresponse)<br> |
|
|
| 202 | Import pending confirmation | **application/json**: [SnippetImportResponse](#snippetimportresponse)<br> |
|
|
| 400 | Import failed | |
|
|
|
|
### [POST] /workspaces/current/customized-snippets/imports/{import_id}/confirm
|
|
**Confirm a pending snippet import**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| import_id | path | Import ID to confirm | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Import confirmed successfully | **application/json**: [SnippetImportResponse](#snippetimportresponse)<br> |
|
|
| 400 | Import failed | |
|
|
|
|
### [DELETE] /workspaces/current/customized-snippets/{snippet_id}
|
|
**Delete customized snippet**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Snippet deleted successfully |
|
|
| 404 | Snippet not found |
|
|
|
|
### [GET] /workspaces/current/customized-snippets/{snippet_id}
|
|
**Get customized snippet details**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Snippet retrieved successfully | **application/json**: [SnippetResponse](#snippetresponse)<br> |
|
|
| 404 | Snippet not found | |
|
|
|
|
### [PATCH] /workspaces/current/customized-snippets/{snippet_id}
|
|
**Update customized snippet**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [UpdateSnippetPayload](#updatesnippetpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Snippet updated successfully | **application/json**: [SnippetResponse](#snippetresponse)<br> |
|
|
| 400 | Invalid request | |
|
|
| 404 | Snippet not found | |
|
|
|
|
### [GET] /workspaces/current/customized-snippets/{snippet_id}/check-dependencies
|
|
**Check dependencies for a snippet**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | Snippet ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Dependencies checked successfully | **application/json**: [SnippetDependencyCheckResponse](#snippetdependencycheckresponse)<br> |
|
|
| 404 | Snippet not found | |
|
|
|
|
### [GET] /workspaces/current/customized-snippets/{snippet_id}/export
|
|
**Export snippet as DSL**
|
|
|
|
Export snippet configuration as DSL
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | Snippet ID to export | Yes | string (uuid) |
|
|
| include_secret | query | Whether to include secret variables | No | string, <br>**Default:** false |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Snippet exported successfully | **application/json**: [TextFileResponse](#textfileresponse)<br> |
|
|
| 404 | Snippet not found | |
|
|
|
|
### [POST] /workspaces/current/customized-snippets/{snippet_id}/use-count/increment
|
|
**Increment snippet use count when it is inserted into a workflow**
|
|
|
|
Increment snippet use count by 1
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| snippet_id | path | Snippet ID | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Use count incremented successfully | **application/json**: [SnippetUseCountResponse](#snippetusecountresponse)<br> |
|
|
| 404 | Snippet not found | |
|
|
|
|
### [GET] /workspaces/current/dataset-operators
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccountWithRoleListResponse](#accountwithrolelistresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/default-model
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| model_type | query | Enum class for model type. | Yes | string, <br>**Available values:** "llm", "moderation", "rerank", "speech2text", "text-embedding", "tts" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Default model retrieved successfully | **application/json**: [DefaultModelDataResponse](#defaultmodeldataresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/default-model
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserPostDefault](#parserpostdefault)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/endpoints
|
|
Create a new plugin endpoint
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [EndpointCreatePayload](#endpointcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Endpoint created successfully | **application/json**: [SuccessResponse](#successresponse)<br> |
|
|
| 403 | Admin privileges required | |
|
|
|
|
### ~~[POST] /workspaces/current/endpoints/create~~
|
|
|
|
***DEPRECATED***
|
|
|
|
Deprecated legacy alias for creating a plugin endpoint. Use POST /workspaces/current/endpoints instead.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [EndpointCreatePayload](#endpointcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Endpoint created successfully | **application/json**: [SuccessResponse](#successresponse)<br> |
|
|
| 403 | Admin privileges required | |
|
|
|
|
### ~~[POST] /workspaces/current/endpoints/delete~~
|
|
|
|
***DEPRECATED***
|
|
|
|
Deprecated legacy alias for deleting a plugin endpoint. Use DELETE /workspaces/current/endpoints/{id} instead.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [EndpointIdPayload](#endpointidpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Endpoint deleted successfully | **application/json**: [SuccessResponse](#successresponse)<br> |
|
|
| 403 | Admin privileges required | |
|
|
|
|
### [POST] /workspaces/current/endpoints/disable
|
|
Disable a plugin endpoint
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [EndpointIdPayload](#endpointidpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Endpoint disabled successfully | **application/json**: [SuccessResponse](#successresponse)<br> |
|
|
| 403 | Admin privileges required | |
|
|
|
|
### [POST] /workspaces/current/endpoints/enable
|
|
Enable a plugin endpoint
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [EndpointIdPayload](#endpointidpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Endpoint enabled successfully | **application/json**: [SuccessResponse](#successresponse)<br> |
|
|
| 403 | Admin privileges required | |
|
|
|
|
### [GET] /workspaces/current/endpoints/list
|
|
List plugin endpoints with pagination
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| page | query | | Yes | integer |
|
|
| page_size | query | | Yes | integer |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [EndpointListResponse](#endpointlistresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/endpoints/list/plugin
|
|
List endpoints for a specific plugin
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| page | query | | Yes | integer |
|
|
| page_size | query | | Yes | integer |
|
|
| plugin_id | query | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [EndpointListResponse](#endpointlistresponse)<br> |
|
|
|
|
### ~~[POST] /workspaces/current/endpoints/update~~
|
|
|
|
***DEPRECATED***
|
|
|
|
Deprecated legacy alias for updating a plugin endpoint. Use PATCH /workspaces/current/endpoints/{id} instead.
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [LegacyEndpointUpdatePayload](#legacyendpointupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Endpoint updated successfully | **application/json**: [SuccessResponse](#successresponse)<br> |
|
|
| 403 | Admin privileges required | |
|
|
|
|
### [DELETE] /workspaces/current/endpoints/{id}
|
|
Delete a plugin endpoint
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| id | path | Endpoint ID | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Endpoint deleted successfully | **application/json**: [SuccessResponse](#successresponse)<br> |
|
|
| 403 | Admin privileges required | |
|
|
|
|
### [PATCH] /workspaces/current/endpoints/{id}
|
|
Update a plugin endpoint
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| id | path | Endpoint ID | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [EndpointUpdatePayload](#endpointupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Endpoint updated successfully | **application/json**: [SuccessResponse](#successresponse)<br> |
|
|
| 403 | Admin privileges required | |
|
|
|
|
### [GET] /workspaces/current/members
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccountWithRoleListResponse](#accountwithrolelistresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/members/invite-email
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MemberInvitePayload](#memberinvitepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Success | **application/json**: [MemberInviteResponse](#memberinviteresponse)<br> |
|
|
| 400 | Invalid role or workspace member limit exceeded | **application/json**: [MemberInviteErrorResponse](#memberinviteerrorresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/members/owner-transfer-check
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [OwnerTransferCheckPayload](#ownertransfercheckpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [VerificationTokenResponse](#verificationtokenresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/members/send-owner-transfer-confirm-email
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [OwnerTransferEmailPayload](#ownertransferemailpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultDataResponse](#simpleresultdataresponse)<br> |
|
|
|
|
### [DELETE] /workspaces/current/members/{member_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| member_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [MemberActionResponse](#memberactionresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/members/{member_id}/owner-transfer
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| member_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [OwnerTransferPayload](#ownertransferpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [PUT] /workspaces/current/members/{member_id}/update-role
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| member_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MemberRoleUpdatePayload](#memberroleupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/model-providers
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| model_type | query | Enum class for model type. | No | string, <br>**Available values:** "llm", "moderation", "rerank", "speech2text", "text-embedding", "tts" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Model providers retrieved successfully | **application/json**: [ModelProviderListResponse](#modelproviderlistresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/model-providers/{provider}/checkout-url
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Model provider checkout URL retrieved successfully | **application/json**: [ModelProviderPaymentCheckoutUrlResponse](#modelproviderpaymentcheckouturlresponse)<br> |
|
|
|
|
### [DELETE] /workspaces/current/model-providers/{provider}/credentials
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserCredentialDelete](#parsercredentialdelete)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Credential deleted successfully |
|
|
|
|
### [GET] /workspaces/current/model-providers/{provider}/credentials
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| credential_id | query | | No | string |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Provider credentials retrieved successfully | **application/json**: [ProviderCredentialsResponse](#providercredentialsresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/model-providers/{provider}/credentials
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserCredentialCreate](#parsercredentialcreate)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Credential created successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [PUT] /workspaces/current/model-providers/{provider}/credentials
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserCredentialUpdate](#parsercredentialupdate)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Credential updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/model-providers/{provider}/credentials/switch
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserCredentialSwitch](#parsercredentialswitch)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/model-providers/{provider}/credentials/validate
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserCredentialValidate](#parsercredentialvalidate)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Provider credentials validated successfully | **application/json**: [ValidationResultResponse](#validationresultresponse)<br> |
|
|
|
|
### [DELETE] /workspaces/current/model-providers/{provider}/models
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserDeleteModels](#parserdeletemodels)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Model deleted successfully |
|
|
|
|
### [GET] /workspaces/current/model-providers/{provider}/models
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Provider models retrieved successfully | **application/json**: [ProviderModelListResponse](#providermodellistresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/model-providers/{provider}/models
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserPostModels](#parserpostmodels)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Model updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [DELETE] /workspaces/current/model-providers/{provider}/models/credentials
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserDeleteCredential](#parserdeletecredential)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 204 | Credential deleted successfully |
|
|
|
|
### [GET] /workspaces/current/model-providers/{provider}/models/credentials
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| config_from | query | | No | string |
|
|
| credential_id | query | | No | string |
|
|
| model | query | | Yes | string |
|
|
| model_type | query | Enum class for model type. | Yes | string, <br>**Available values:** "llm", "moderation", "rerank", "speech2text", "text-embedding", "tts" |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Model credentials retrieved successfully | **application/json**: [ModelCredentialResponse](#modelcredentialresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/model-providers/{provider}/models/credentials
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserCreateCredential](#parsercreatecredential)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Model credential created successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [PUT] /workspaces/current/model-providers/{provider}/models/credentials
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserUpdateCredential](#parserupdatecredential)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Model credential updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/model-providers/{provider}/models/credentials/switch
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserSwitch](#parserswitch)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/model-providers/{provider}/models/credentials/validate
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserValidate](#parservalidate)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Model credentials validated successfully | **application/json**: [ValidationResultResponse](#validationresultresponse)<br> |
|
|
|
|
### [PATCH] /workspaces/current/model-providers/{provider}/models/disable
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserDeleteModels](#parserdeletemodels)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [PATCH] /workspaces/current/model-providers/{provider}/models/enable
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserDeleteModels](#parserdeletemodels)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/model-providers/{provider}/models/load-balancing-configs/credentials-validate
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [LoadBalancingCredentialPayload](#loadbalancingcredentialpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Credential validation result | **application/json**: [LoadBalancingCredentialValidateResponse](#loadbalancingcredentialvalidateresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/model-providers/{provider}/models/load-balancing-configs/{config_id}/credentials-validate
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| config_id | path | | Yes | string |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [LoadBalancingCredentialPayload](#loadbalancingcredentialpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Credential validation result | **application/json**: [LoadBalancingCredentialValidateResponse](#loadbalancingcredentialvalidateresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/model-providers/{provider}/models/parameter-rules
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| model | query | | Yes | string |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Model parameter rules retrieved successfully | **application/json**: [ModelParameterRuleListResponse](#modelparameterrulelistresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/model-providers/{provider}/preferred-provider-type
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserPreferredProviderType](#parserpreferredprovidertype)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/models/model-types/{model_type}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| model_type | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Available models retrieved successfully | **application/json**: [AvailableModelListResponse](#availablemodellistresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/permission
|
|
**Get workspace permission settings**
|
|
|
|
Returns permission flags that control workspace features like member invitations and owner transfer.
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [WorkspacePermissionResponse](#workspacepermissionresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/plugin/asset
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| file_name | query | | Yes | string |
|
|
| plugin_unique_identifier | query | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [BinaryFileResponse](#binaryfileresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/auto-upgrade/change
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserAutoUpgradeChange](#parserautoupgradechange)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginAutoUpgradeChangeResponse](#pluginautoupgradechangeresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/auto-upgrade/exclude
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserExcludePlugin](#parserexcludeplugin)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SuccessResponse](#successresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/plugin/auto-upgrade/fetch
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| category | query | | Yes | string, <br>**Available values:** "agent-strategy", "datasource", "extension", "model", "tool", "trigger" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginAutoUpgradeFetchResponse](#pluginautoupgradefetchresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/plugin/debugging-key
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginDebuggingKeyResponse](#plugindebuggingkeyresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/plugin/fetch-manifest
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| plugin_unique_identifier | query | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginManifestResponse](#pluginmanifestresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/plugin/icon
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| filename | query | | Yes | string |
|
|
| tenant_id | query | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [BinaryFileResponse](#binaryfileresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/install/github
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserGithubInstall](#parsergithubinstall)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginInstallTaskStartResponse](#plugininstalltaskstartresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/install/marketplace
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserPluginIdentifiers](#parserpluginidentifiers)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginInstallTaskStartResponse](#plugininstalltaskstartresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/install/pkg
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserPluginIdentifiers](#parserpluginidentifiers)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginInstallTaskStartResponse](#plugininstalltaskstartresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/plugin/list
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| page | query | Page number | No | integer, <br>**Default:** 1 |
|
|
| page_size | query | Page size (1-256) | No | integer, <br>**Default:** 256 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginListResponse](#pluginlistresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/list/installations/ids
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserLatest](#parserlatest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginInstallationsResponse](#plugininstallationsresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/list/latest-versions
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserLatest](#parserlatest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginVersionsResponse](#pluginversionsresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/plugin/marketplace/pkg
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| plugin_unique_identifier | query | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginManifestResponse](#pluginmanifestresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/plugin/parameters/dynamic-options
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| action | query | | Yes | string |
|
|
| credential_id | query | | No | string |
|
|
| parameter | query | | Yes | string |
|
|
| plugin_id | query | | Yes | string |
|
|
| provider | query | | Yes | string |
|
|
| provider_type | query | | Yes | string, <br>**Available values:** "tool", "trigger" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginDynamicOptionsResponse](#plugindynamicoptionsresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/parameters/dynamic-options-with-credentials
|
|
**Fetch dynamic options using credentials directly (for edit mode)**
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserDynamicOptionsWithCredentials](#parserdynamicoptionswithcredentials)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginDynamicOptionsResponse](#plugindynamicoptionsresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/permission/change
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserPermissionChange](#parserpermissionchange)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SuccessResponse](#successresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/plugin/permission/fetch
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginPermissionResponse](#pluginpermissionresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/plugin/readme
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| language | query | | No | string, <br>**Default:** en-US |
|
|
| plugin_unique_identifier | query | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginReadmeResponse](#pluginreadmeresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/plugin/tasks
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| page | query | Page number | No | integer, <br>**Default:** 1 |
|
|
| page_size | query | Page size (1-256) | No | integer, <br>**Default:** 256 |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginTasksResponse](#plugintasksresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/tasks/delete_all
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SuccessResponse](#successresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/plugin/tasks/{task_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginTaskResponse](#plugintaskresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/tasks/{task_id}/delete
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SuccessResponse](#successresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/tasks/{task_id}/delete/{identifier}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| identifier | path | | Yes | string |
|
|
| task_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SuccessResponse](#successresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/uninstall
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserUninstall](#parseruninstall)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SuccessResponse](#successresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/upgrade/github
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserGithubUpgrade](#parsergithubupgrade)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginInstallTaskStartResponse](#plugininstalltaskstartresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/upgrade/marketplace
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserMarketplaceUpgrade](#parsermarketplaceupgrade)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginInstallTaskStartResponse](#plugininstalltaskstartresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/upload/bundle
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginBundleUploadResponse](#pluginbundleuploadresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/upload/github
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ParserGithubUpload](#parsergithubupload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginDecodeResponse](#plugindecoderesponse)<br> |
|
|
|
|
### [POST] /workspaces/current/plugin/upload/pkg
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"pkg"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginDecodeResponse](#plugindecoderesponse)<br> |
|
|
|
|
### [GET] /workspaces/current/plugin/{category}/list
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| page | query | Page number | No | integer, <br>**Default:** 1 |
|
|
| page_size | query | Page size (1-256) | No | integer, <br>**Default:** 256 |
|
|
| category | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PluginCategoryListResponse](#plugincategorylistresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/access-policies
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [_AccessPolicyList](#_accesspolicylist)<br> |
|
|
|
|
### [POST] /workspaces/current/rbac/access-policies
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Policy created | **application/json**: [AccessPolicy](#accesspolicy)<br> |
|
|
|
|
### [DELETE] /workspaces/current/rbac/access-policies/{policy_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| policy_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccessPolicy](#accesspolicy)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/access-policies/{policy_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| policy_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccessPolicy](#accesspolicy)<br> |
|
|
|
|
### [PUT] /workspaces/current/rbac/access-policies/{policy_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| policy_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccessPolicy](#accesspolicy)<br> |
|
|
|
|
### [POST] /workspaces/current/rbac/access-policies/{policy_id}/copy
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| policy_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Policy copied | **application/json**: [AccessPolicy](#accesspolicy)<br> |
|
|
|
|
### [PUT] /workspaces/current/rbac/access-policy-bindings/{binding_id}/lock
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| binding_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccessPolicyBindingState](#accesspolicybindingstate)<br> |
|
|
|
|
### [PUT] /workspaces/current/rbac/access-policy-bindings/{binding_id}/unlock
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| binding_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccessPolicyBindingState](#accesspolicybindingstate)<br> |
|
|
|
|
### [DELETE] /workspaces/current/rbac/apps/{app_id}/access-policies/{policy_id}/member-bindings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| policy_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [_DeleteMemberBindingsRequest](#_deletememberbindingsrequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [MemberBindingsResponse](#memberbindingsresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/apps/{app_id}/access-policies/{policy_id}/member-bindings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| policy_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [MemberBindingsResponse](#memberbindingsresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/apps/{app_id}/access-policies/{policy_id}/role-bindings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| policy_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RoleBindingsResponse](#rolebindingsresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/apps/{app_id}/access-policy
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| language | query | Localized policy label language | No | string, <br>**Available values:** "en", "ja", "zh" |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AppAccessMatrix](#appaccessmatrix)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/apps/{app_id}/user-access-policies
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| language | query | Localized policy label language | No | string, <br>**Available values:** "en", "ja", "zh" |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ResourceUserAccessPoliciesResponse](#resourceuseraccesspoliciesresponse)<br> |
|
|
|
|
### [PUT] /workspaces/current/rbac/apps/{app_id}/users/{target_account_id}/access-policies
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
| target_account_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ReplaceUserAccessPolicies](#replaceuseraccesspolicies)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ReplaceUserAccessPoliciesResponse](#replaceuseraccesspoliciesresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/apps/{app_id}/whitelist
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ResourceWhitelist](#resourcewhitelist)<br> |
|
|
|
|
### [PUT] /workspaces/current/rbac/apps/{app_id}/whitelist
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| app_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [_ResourceAccessScopeRequest](#_resourceaccessscoperequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ResourceWhitelist](#resourcewhitelist)<br> |
|
|
|
|
### [DELETE] /workspaces/current/rbac/datasets/{dataset_id}/access-policies/{policy_id}/member-bindings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| policy_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [_DeleteMemberBindingsRequest](#_deletememberbindingsrequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [MemberBindingsResponse](#memberbindingsresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/datasets/{dataset_id}/access-policies/{policy_id}/member-bindings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| policy_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [MemberBindingsResponse](#memberbindingsresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/datasets/{dataset_id}/access-policies/{policy_id}/role-bindings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| policy_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RoleBindingsResponse](#rolebindingsresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/datasets/{dataset_id}/access-policy
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| language | query | Localized policy label language | No | string, <br>**Available values:** "en", "ja", "zh" |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [DatasetAccessMatrix](#datasetaccessmatrix)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/datasets/{dataset_id}/user-access-policies
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| language | query | Localized policy label language | No | string, <br>**Available values:** "en", "ja", "zh" |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ResourceUserAccessPoliciesResponse](#resourceuseraccesspoliciesresponse)<br> |
|
|
|
|
### [PUT] /workspaces/current/rbac/datasets/{dataset_id}/users/{target_account_id}/access-policies
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
| target_account_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ReplaceUserAccessPolicies](#replaceuseraccesspolicies)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ReplaceUserAccessPoliciesResponse](#replaceuseraccesspoliciesresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/datasets/{dataset_id}/whitelist
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ResourceWhitelist](#resourcewhitelist)<br> |
|
|
|
|
### [PUT] /workspaces/current/rbac/datasets/{dataset_id}/whitelist
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| dataset_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [_ResourceAccessScopeRequest](#_resourceaccessscoperequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [ResourceWhitelist](#resourcewhitelist)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/members/{member_id}/rbac-roles
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| member_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [MemberRolesResponse](#memberrolesresponse)<br> |
|
|
|
|
### [PUT] /workspaces/current/rbac/members/{member_id}/rbac-roles
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| member_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [_ReplaceMemberRolesRequest](#_replacememberrolesrequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [MemberRolesResponse](#memberrolesresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/my-permissions
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [MyPermissionsResponse](#mypermissionsresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/role-permissions/catalog
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PermissionCatalogResponse](#permissioncatalogresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/role-permissions/catalog/app
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PermissionCatalogResponse](#permissioncatalogresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/role-permissions/catalog/dataset
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [PermissionCatalogResponse](#permissioncatalogresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/roles
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [_RBACRoleList](#_rbacrolelist)<br> |
|
|
|
|
### [POST] /workspaces/current/rbac/roles
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Role created | **application/json**: [RBACRole](#rbacrole)<br> |
|
|
|
|
### [DELETE] /workspaces/current/rbac/roles/{role_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| role_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RBACRole](#rbacrole)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/roles/{role_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| role_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RBACRole](#rbacrole)<br> |
|
|
|
|
### [PUT] /workspaces/current/rbac/roles/{role_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| role_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RBACRole](#rbacrole)<br> |
|
|
|
|
### [POST] /workspaces/current/rbac/roles/{role_id}/copy
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| role_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Role copied | **application/json**: [RBACRole](#rbacrole)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/roles/{role_id}/members
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| role_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [_MembersInRoleList](#_membersinrolelist)<br> |
|
|
|
|
### [PUT] /workspaces/current/rbac/workspace/apps/access-policies/{policy_id}/bindings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| policy_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [_ReplaceBindingsRequest](#_replacebindingsrequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccessMatrixItem](#accessmatrixitem)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/workspace/apps/access-policies/{policy_id}/member-bindings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| policy_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [MemberBindingsResponse](#memberbindingsresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/workspace/apps/access-policies/{policy_id}/role-bindings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| policy_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RoleBindingsResponse](#rolebindingsresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/workspace/apps/access-policy
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [WorkspaceAccessMatrix](#workspaceaccessmatrix)<br> |
|
|
|
|
### [PUT] /workspaces/current/rbac/workspace/datasets/access-policies/{policy_id}/bindings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| policy_id | path | | Yes | string (uuid) |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [_ReplaceBindingsRequest](#_replacebindingsrequest)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [AccessMatrixItem](#accessmatrixitem)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/workspace/datasets/access-policies/{policy_id}/member-bindings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| policy_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [MemberBindingsResponse](#memberbindingsresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/workspace/datasets/access-policies/{policy_id}/role-bindings
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| policy_id | path | | Yes | string (uuid) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [RoleBindingsResponse](#rolebindingsresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/rbac/workspace/datasets/access-policy
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [WorkspaceAccessMatrix](#workspaceaccessmatrix)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-labels
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Tool labels retrieved successfully | **application/json**: [ToolLabelListResponse](#toollabellistresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/tool-provider/api/add
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ApiToolProviderAddPayload](#apitoolprovideraddpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | API provider added successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/tool-provider/api/delete
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ApiToolProviderDeletePayload](#apitoolproviderdeletepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | API provider deleted successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-provider/api/get
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | query | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | API provider retrieved successfully | **application/json**: [ApiProviderDetailResponse](#apiproviderdetailresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-provider/api/remote
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| url | query | | Yes | string (uri) |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Remote API provider schema retrieved successfully | **application/json**: [ApiProviderRemoteSchemaResponse](#apiproviderremoteschemaresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/tool-provider/api/schema
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ApiToolSchemaPayload](#apitoolschemapayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | API schema parsed successfully | **application/json**: [ApiSchemaParseResponse](#apischemaparseresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/tool-provider/api/test/pre
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ApiToolTestPayload](#apitooltestpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | API tool test preview completed successfully | **application/json**: [ApiToolPreviewResponse](#apitoolpreviewresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-provider/api/tools
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | query | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | API provider tools retrieved successfully | **application/json**: [ToolApiListResponse](#toolapilistresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/tool-provider/api/update
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ApiToolProviderUpdatePayload](#apitoolproviderupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | API provider updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/tool-provider/builtin/{provider}/add
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [BuiltinToolAddPayload](#builtintooladdpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Builtin provider added successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-provider/builtin/{provider}/credential/info
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| include_credential_ids | query | Credential IDs to include even if visibility would hide them | No | [ string ] |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Builtin provider credential info retrieved successfully | **application/json**: [ToolProviderCredentialInfoApiEntity](#toolprovidercredentialinfoapientity)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-provider/builtin/{provider}/credential/schema/{credential_type}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| credential_type | path | | Yes | string |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Builtin provider credential schema retrieved successfully | **application/json**: [ProviderConfigListResponse](#providerconfiglistresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-provider/builtin/{provider}/credentials
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| include_credential_ids | query | Credential IDs to include even if visibility would hide them | No | [ string ] |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Builtin provider credentials retrieved successfully | **application/json**: [ToolProviderCredentialListResponse](#toolprovidercredentiallistresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/tool-provider/builtin/{provider}/default-credential
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [BuiltinProviderDefaultCredentialPayload](#builtinproviderdefaultcredentialpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Default credential set successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/tool-provider/builtin/{provider}/delete
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [BuiltinToolCredentialDeletePayload](#builtintoolcredentialdeletepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Builtin provider credential deleted successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-provider/builtin/{provider}/icon
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Builtin provider icon |
|
|
|
|
### [GET] /workspaces/current/tool-provider/builtin/{provider}/info
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Builtin provider info retrieved successfully | **application/json**: [ToolProviderApiEntityResponse](#toolproviderapientityresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-provider/builtin/{provider}/oauth/client-schema
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Builtin provider OAuth client schema retrieved successfully | **application/json**: [BuiltinProviderOAuthClientSchemaResponse](#builtinprovideroauthclientschemaresponse)<br> |
|
|
|
|
### [DELETE] /workspaces/current/tool-provider/builtin/{provider}/oauth/custom-client
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Custom OAuth client deleted successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-provider/builtin/{provider}/oauth/custom-client
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Custom OAuth client retrieved successfully |
|
|
|
|
### [POST] /workspaces/current/tool-provider/builtin/{provider}/oauth/custom-client
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [ToolOAuthCustomClientPayload](#tooloauthcustomclientpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Custom OAuth client saved successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-provider/builtin/{provider}/tools
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Builtin provider tools retrieved successfully | **application/json**: [ToolApiListResponse](#toolapilistresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/tool-provider/builtin/{provider}/update
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [BuiltinToolUpdatePayload](#builtintoolupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Builtin provider updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [DELETE] /workspaces/current/tool-provider/mcp
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MCPProviderDeletePayload](#mcpproviderdeletepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/tool-provider/mcp
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MCPProviderCreatePayload](#mcpprovidercreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | MCP provider created successfully | **application/json**: [ToolProviderApiEntityResponse](#toolproviderapientityresponse)<br> |
|
|
|
|
### [PUT] /workspaces/current/tool-provider/mcp
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MCPProviderUpdatePayload](#mcpproviderupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | MCP provider updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/tool-provider/mcp/auth
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [MCPAuthPayload](#mcpauthpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | MCP provider authorized successfully | **application/json**: [MCPAuthResponse](#mcpauthresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-provider/mcp/tools/{provider_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | MCP provider retrieved successfully | **application/json**: [ToolProviderApiEntityResponse](#toolproviderapientityresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-provider/mcp/update/{provider_id}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | MCP provider tools refreshed successfully | **application/json**: [ToolProviderApiEntityResponse](#toolproviderapientityresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/tool-provider/workflow/create
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowToolCreatePayload](#workflowtoolcreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow tool created successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/tool-provider/workflow/delete
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowToolDeletePayload](#workflowtooldeletepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow tool deleted successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-provider/workflow/get
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| workflow_app_id | query | | No | string |
|
|
| workflow_tool_id | query | | No | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow tool retrieved successfully | **application/json**: [WorkflowToolDetailResponse](#workflowtooldetailresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-provider/workflow/tools
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| workflow_tool_id | query | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow provider tools retrieved successfully | **application/json**: [ToolApiListResponse](#toolapilistresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/tool-provider/workflow/update
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkflowToolUpdatePayload](#workflowtoolupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow tool updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tool-providers
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| type | query | | No | string, <br>**Available values:** "api", "builtin", "mcp", "model", "workflow" |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Tool providers retrieved successfully | **application/json**: [ToolProviderListResponse](#toolproviderlistresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tools/api
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | API tools retrieved successfully | **application/json**: [ToolProviderListResponse](#toolproviderlistresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tools/builtin
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Builtin tools retrieved successfully | **application/json**: [ToolProviderListResponse](#toolproviderlistresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tools/mcp
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | MCP tools retrieved successfully | **application/json**: [ToolProviderListResponse](#toolproviderlistresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/tools/workflow
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Workflow tools retrieved successfully | **application/json**: [ToolProviderListResponse](#toolproviderlistresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/trigger-provider/{provider}/icon
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Trigger provider icon |
|
|
|
|
### [GET] /workspaces/current/trigger-provider/{provider}/info
|
|
**Get info for a trigger provider**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger provider retrieved successfully | **application/json**: [TriggerProviderApiEntity](#triggerproviderapientity)<br> |
|
|
|
|
### [DELETE] /workspaces/current/trigger-provider/{provider}/oauth/client
|
|
**Remove custom OAuth client configuration**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger OAuth client deleted successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/trigger-provider/{provider}/oauth/client
|
|
**Get OAuth client configuration for a provider**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger OAuth client retrieved successfully | **application/json**: [TriggerOAuthClientResponse](#triggeroauthclientresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/trigger-provider/{provider}/oauth/client
|
|
**Configure custom OAuth client for a provider**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TriggerOAuthClientPayload](#triggeroauthclientpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger OAuth client saved successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/trigger-provider/{provider}/subscriptions/builder/build/{subscription_builder_id}
|
|
**Build a subscription instance for a trigger provider**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
| subscription_builder_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TriggerSubscriptionBuilderUpdatePayload](#triggersubscriptionbuilderupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger subscription builder built successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/trigger-provider/{provider}/subscriptions/builder/create
|
|
**Add a new subscription instance for a trigger provider**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TriggerSubscriptionBuilderCreatePayload](#triggersubscriptionbuildercreatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger subscription builder created successfully | **application/json**: [TriggerSubscriptionBuilderCreateResponse](#triggersubscriptionbuildercreateresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/trigger-provider/{provider}/subscriptions/builder/logs/{subscription_builder_id}
|
|
**Get the request logs for a subscription instance for a trigger provider**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
| subscription_builder_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger subscription builder logs retrieved successfully | **application/json**: [TriggerSubscriptionBuilderLogsResponse](#triggersubscriptionbuilderlogsresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/trigger-provider/{provider}/subscriptions/builder/update/{subscription_builder_id}
|
|
**Update a subscription instance for a trigger provider**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
| subscription_builder_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TriggerSubscriptionBuilderUpdatePayload](#triggersubscriptionbuilderupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger subscription builder updated successfully | **application/json**: [SubscriptionBuilderApiEntity](#subscriptionbuilderapientity)<br> |
|
|
|
|
### [POST] /workspaces/current/trigger-provider/{provider}/subscriptions/builder/verify-and-update/{subscription_builder_id}
|
|
**Verify and update a subscription instance for a trigger provider**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
| subscription_builder_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TriggerSubscriptionBuilderVerifyPayload](#triggersubscriptionbuilderverifypayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger subscription builder verified successfully | **application/json**: [TriggerVerificationResponse](#triggerverificationresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/trigger-provider/{provider}/subscriptions/builder/{subscription_builder_id}
|
|
**Get a subscription instance for a trigger provider**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
| subscription_builder_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger subscription builder retrieved successfully | **application/json**: [SubscriptionBuilderApiEntity](#subscriptionbuilderapientity)<br> |
|
|
|
|
### [GET] /workspaces/current/trigger-provider/{provider}/subscriptions/list
|
|
**List all trigger subscriptions for the current tenant's provider**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger subscriptions retrieved successfully | **application/json**: [TriggerProviderSubscriptionListResponse](#triggerprovidersubscriptionlistresponse)<br> |
|
|
| 404 | Trigger provider not found | **application/json**: [TriggerProviderErrorResponse](#triggerprovidererrorresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/trigger-provider/{provider}/subscriptions/oauth/authorize
|
|
**Initiate OAuth authorization flow for a trigger provider**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger OAuth authorization URL generated successfully | **application/json**: [TriggerOAuthAuthorizeResponse](#triggeroauthauthorizeresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/trigger-provider/{provider}/subscriptions/verify/{subscription_id}
|
|
**Verify credentials for an existing subscription (edit mode only)**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| provider | path | | Yes | string |
|
|
| subscription_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TriggerSubscriptionBuilderVerifyPayload](#triggersubscriptionbuilderverifypayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger subscription verified successfully | **application/json**: [TriggerVerificationResponse](#triggerverificationresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/trigger-provider/{subscription_id}/subscriptions/delete
|
|
**Delete a subscription instance**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| subscription_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/current/trigger-provider/{subscription_id}/subscriptions/update
|
|
**Update a subscription instance**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| subscription_id | path | | Yes | string |
|
|
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [TriggerSubscriptionBuilderUpdatePayload](#triggersubscriptionbuilderupdatepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger subscription updated successfully | **application/json**: [SimpleResultResponse](#simpleresultresponse)<br> |
|
|
|
|
### [GET] /workspaces/current/triggers
|
|
**List all trigger providers for the current tenant**
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Trigger providers retrieved successfully | **application/json**: [TriggerProviderListResponse](#triggerproviderlistresponse)<br> |
|
|
|
|
### [POST] /workspaces/custom-config
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkspaceCustomConfigPayload](#workspacecustomconfigpayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [WorkspaceTenantResultResponse](#workspacetenantresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/custom-config/webapp-logo/upload
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **multipart/form-data**: { **"file"**: binary }<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Logo uploaded | **application/json**: [WorkspaceLogoUploadResponse](#workspacelogouploadresponse)<br> |
|
|
|
|
### [POST] /workspaces/info
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [WorkspaceInfoPayload](#workspaceinfopayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [WorkspaceTenantResultResponse](#workspacetenantresultresponse)<br> |
|
|
|
|
### [POST] /workspaces/switch
|
|
#### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [SwitchWorkspacePayload](#switchworkspacepayload)<br> |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [SwitchWorkspaceResponse](#switchworkspaceresponse)<br> |
|
|
|
|
### [GET] /workspaces/{tenant_id}/model-providers/{provider}/{icon_type}/{lang}
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| icon_type | path | | Yes | string |
|
|
| lang | path | | Yes | string |
|
|
| provider | path | | Yes | string |
|
|
| tenant_id | path | | Yes | string |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description |
|
|
| ---- | ----------- |
|
|
| 200 | Model provider icon |
|
|
|
|
---
|
|
## default
|
|
Default namespace
|
|
|
|
### [GET] /explore/banners
|
|
**Get banner list**
|
|
|
|
#### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| language | query | Banner language | No | string, <br>**Default:** en-US |
|
|
|
|
#### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | Success | **application/json**: [BannerListResponse](#bannerlistresponse)<br> |
|
|
|
|
---
|
|
### Schemas
|
|
|
|
#### AIModelEntity
|
|
|
|
Model class for AI model.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| deprecated | boolean | | No |
|
|
| features | [ [ModelFeature](#modelfeature) ] | | No |
|
|
| fetch_from | [FetchFrom](#fetchfrom) | | Yes |
|
|
| label | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | Yes |
|
|
| model | string | | Yes |
|
|
| model_properties | object | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
| parameter_rules | [ [ParameterRule](#parameterrule) ], <br>**Default:** | | No |
|
|
| pricing | [PriceConfig](#priceconfig) | | No |
|
|
|
|
#### AIModelEntityResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| deprecated | boolean | | No |
|
|
| features | [ [ModelFeature](#modelfeature) ] | | No |
|
|
| fetch_from | [FetchFrom](#fetchfrom) | | Yes |
|
|
| label | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | Yes |
|
|
| model | string | | Yes |
|
|
| model_properties | object | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
| parameter_rules | [ [ParameterRule](#parameterrule) ], <br>**Default:** | | No |
|
|
| pricing | [PriceConfigResponse](#priceconfigresponse) | | No |
|
|
|
|
#### APIBasedExtensionListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| APIBasedExtensionListResponse | array | | |
|
|
|
|
#### APIBasedExtensionPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| api_endpoint | string | API endpoint URL | Yes |
|
|
| api_key | string | API key for authentication | Yes |
|
|
| name | string | Extension name | Yes |
|
|
|
|
#### APIBasedExtensionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| api_endpoint | string | | Yes |
|
|
| api_key | string | | Yes |
|
|
| created_at | integer | | No |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### AccessMatrixItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| accounts | [ [AccessPolicyAccount](#accesspolicyaccount) ] | | No |
|
|
| policy | [AccessPolicy](#accesspolicy) | | No |
|
|
| roles | [ [AccessPolicyRole](#accesspolicyrole) ] | | No |
|
|
|
|
#### AccessPolicy
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| category | string | | No |
|
|
| created_at | integer | | No |
|
|
| description | string | | No |
|
|
| id | string | | Yes |
|
|
| is_builtin | boolean | | No |
|
|
| name | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
| policy_key | string | | No |
|
|
| resource_type | string | | Yes |
|
|
| tenant_id | string | | No |
|
|
| updated_at | integer | | No |
|
|
|
|
#### AccessPolicyAccount
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| account_id | string | | Yes |
|
|
| account_name | string | | Yes |
|
|
| avatar | string | | No |
|
|
| binding_id | string | | Yes |
|
|
| email | string | | No |
|
|
| is_locked | boolean | | No |
|
|
|
|
#### AccessPolicyBindingState
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| binding_id | string | | Yes |
|
|
| is_locked | boolean | | No |
|
|
|
|
#### AccessPolicyMemberBinding
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_policy_id | string | | Yes |
|
|
| account_id | string | | Yes |
|
|
| account_name | string | | No |
|
|
| created_at | integer | | No |
|
|
| id | string | | Yes |
|
|
| resource_id | string | | No |
|
|
| resource_type | string | | Yes |
|
|
| tenant_id | string | | No |
|
|
|
|
#### AccessPolicyRole
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| binding_id | string | | Yes |
|
|
| is_locked | boolean | | No |
|
|
| role_id | string | | Yes |
|
|
| role_name | string | | Yes |
|
|
| role_tag | string | | No |
|
|
|
|
#### AccessPolicyRoleBinding
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_policy_id | string | | Yes |
|
|
| created_at | integer | | No |
|
|
| id | string | | Yes |
|
|
| resource_id | string | | No |
|
|
| resource_type | string | | Yes |
|
|
| role_id | string | | Yes |
|
|
| role_name | string | | No |
|
|
| tenant_id | string | | No |
|
|
|
|
#### AccountAvatarPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| avatar | string | | Yes |
|
|
|
|
#### AccountAvatarQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| avatar | string | Avatar file ID | Yes |
|
|
|
|
#### AccountDeletePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | | Yes |
|
|
| token | string | | Yes |
|
|
|
|
#### AccountDeletionFeedbackPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | Yes |
|
|
| feedback | string | | Yes |
|
|
|
|
#### AccountInitPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| interface_language | string | | Yes |
|
|
| invitation_code | string | | No |
|
|
| timezone | string | | Yes |
|
|
|
|
#### AccountIntegrateListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AccountIntegrateResponse](#accountintegrateresponse) ] | | Yes |
|
|
|
|
#### AccountIntegrateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| is_bound | boolean | | Yes |
|
|
| link | string | | No |
|
|
| provider | string | | Yes |
|
|
|
|
#### AccountInterfaceLanguagePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| interface_language | string | | Yes |
|
|
|
|
#### AccountInterfaceThemePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| interface_theme | string, <br>**Available values:** "dark", "light" | *Enum:* `"dark"`, `"light"` | Yes |
|
|
|
|
#### AccountNamePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | | Yes |
|
|
|
|
#### AccountPasswordPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| new_password | string | | Yes |
|
|
| password | string | | No |
|
|
| repeat_new_password | string | | Yes |
|
|
|
|
#### AccountResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| avatar | string | | No |
|
|
| avatar_url | string | | Yes |
|
|
| created_at | integer | | No |
|
|
| email | string | | Yes |
|
|
| id | string | | Yes |
|
|
| interface_language | string | | No |
|
|
| interface_theme | string | | No |
|
|
| is_password_set | boolean | | Yes |
|
|
| last_login_at | integer | | No |
|
|
| last_login_ip | string | | No |
|
|
| name | string | | Yes |
|
|
| timezone | string | | No |
|
|
|
|
#### AccountTimezonePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| timezone | string | | Yes |
|
|
|
|
#### AccountWithRoleListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| accounts | [ [AccountWithRoleResponse](#accountwithroleresponse) ] | | Yes |
|
|
|
|
#### AccountWithRoleResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| avatar | string | | No |
|
|
| avatar_url | string | | Yes |
|
|
| created_at | integer | | No |
|
|
| email | string | | Yes |
|
|
| id | string | | Yes |
|
|
| last_active_at | integer | | No |
|
|
| last_login_at | integer | | No |
|
|
| name | string | | Yes |
|
|
| role | string | | Yes |
|
|
| roles | [ object ] | | No |
|
|
| status | string | | Yes |
|
|
|
|
#### ActivateCheckQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | No |
|
|
| token | string | | Yes |
|
|
| workspace_id | string | | No |
|
|
|
|
#### ActivatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | No |
|
|
| interface_language | string | | No |
|
|
| name | string | | No |
|
|
| timezone | string | | No |
|
|
| token | string | | Yes |
|
|
| workspace_id | string | | No |
|
|
|
|
#### ActivationCheckData
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| account_status | string | | No |
|
|
| email | string | | Yes |
|
|
| requires_setup | boolean | | No |
|
|
| workspace_id | string | | Yes |
|
|
| workspace_name | string | | Yes |
|
|
|
|
#### ActivationCheckResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ActivationCheckData](#activationcheckdata) | Activation data if valid | No |
|
|
| is_valid | boolean | Whether token is valid | Yes |
|
|
|
|
#### ActivationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | Operation result | Yes |
|
|
|
|
#### AdvancedChatWorkflowRunForListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_id | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by_account | [SimpleAccountResponse](#simpleaccountresponse) | | No |
|
|
| elapsed_time | number | | No |
|
|
| exceptions_count | integer | | No |
|
|
| finished_at | integer | | No |
|
|
| id | string | | Yes |
|
|
| message_id | string | | No |
|
|
| retry_index | integer | | No |
|
|
| status | string | | No |
|
|
| total_steps | integer | | No |
|
|
| total_tokens | integer | | No |
|
|
| version | string | | No |
|
|
|
|
#### AdvancedChatWorkflowRunPaginationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AdvancedChatWorkflowRunForListResponse](#advancedchatworkflowrunforlistresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
|
|
#### AdvancedChatWorkflowRunPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_id | string | | No |
|
|
| files | [ object ] | | No |
|
|
| inputs | object | | No |
|
|
| parent_message_id | string | | No |
|
|
| query | string | | No |
|
|
|
|
#### AdvancedPromptTemplateQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_mode | string | Application mode | Yes |
|
|
| has_context | string, <br>**Default:** true | Whether has context | No |
|
|
| model_mode | string | Model mode | Yes |
|
|
| model_name | string | Model name | Yes |
|
|
|
|
#### AdvancedPromptTemplateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| chat_prompt_config | object | | No |
|
|
| completion_prompt_config | object | | No |
|
|
|
|
#### AgentApiAccessResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| api_key_count | integer | | Yes |
|
|
| api_rph | integer | | Yes |
|
|
| api_rpm | integer | | Yes |
|
|
| chat_endpoint | string | | Yes |
|
|
| conversations_endpoint | string | | Yes |
|
|
| enabled | boolean | | Yes |
|
|
| files_upload_endpoint | string | | Yes |
|
|
| info_endpoint | string | | Yes |
|
|
| messages_endpoint | string | | Yes |
|
|
| meta_endpoint | string | | Yes |
|
|
| parameters_endpoint | string | | Yes |
|
|
| service_api_base_url | string | | Yes |
|
|
| stop_endpoint | string | | Yes |
|
|
| streaming_only | boolean, <br>**Default:** true | | No |
|
|
|
|
#### AgentApiStatusPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enable_api | boolean | Enable or disable Agent service API | Yes |
|
|
|
|
#### AgentAppComposerResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| active_config_is_published | boolean | | Yes |
|
|
| active_config_snapshot | [AgentConfigSnapshotSummaryResponse](#agentconfigsnapshotsummaryresponse) | | No |
|
|
| agent | [AgentComposerAgentResponse](#agentcomposeragentresponse) | | Yes |
|
|
| agent_soul | [AgentSoulConfig](#agentsoulconfig) | | Yes |
|
|
| app_id | string | | No |
|
|
| backing_app_id | string | | No |
|
|
| chat_endpoint | string | | No |
|
|
| draft | [AgentConfigDraftSummaryResponse](#agentconfigdraftsummaryresponse) | | No |
|
|
| hidden_app_backed | boolean | | No |
|
|
| save_options | [ [ComposerSaveStrategy](#composersavestrategy) ] | | Yes |
|
|
| validation | [ComposerValidationFindingsResponse](#composervalidationfindingsresponse) | | No |
|
|
| variant | string | | Yes |
|
|
|
|
#### AgentAppCopyPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | Description for the copied agent | No |
|
|
| icon | string | Icon | No |
|
|
| icon_background | string | Icon background color | No |
|
|
| icon_type | [IconType](#icontype) | Icon type | No |
|
|
| name | string | Name for the copied agent | No |
|
|
| role | string | Role for the copied agent | No |
|
|
|
|
#### AgentAppCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | Agent description (max 400 chars) | No |
|
|
| icon | string | Icon | No |
|
|
| icon_background | string | Icon background color | No |
|
|
| icon_type | [IconType](#icontype) | Icon type | No |
|
|
| name | string | Agent name | Yes |
|
|
| role | string | Agent role | No |
|
|
|
|
#### AgentAppDetailWithSite
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_mode | string | | No |
|
|
| api_base_url | string | | No |
|
|
| app_id | string | | No |
|
|
| backing_app_id | string | | No |
|
|
| bound_agent_id | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| debug_conversation_has_messages | boolean | | No |
|
|
| debug_conversation_id | string | | No |
|
|
| debug_conversation_message_count | integer | | No |
|
|
| deleted_tools | [ [DeletedTool](#deletedtool) ] | | No |
|
|
| description | string | | No |
|
|
| enable_api | boolean | | Yes |
|
|
| enable_site | boolean | | Yes |
|
|
| hidden_app_backed | boolean | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| icon_url | string | | Yes |
|
|
| id | string | | Yes |
|
|
| maintainer | string | | No |
|
|
| max_active_requests | integer | | No |
|
|
| mode | string | | Yes |
|
|
| model_config | [AppModelConfigResponse](#appmodelconfigresponse) | | No |
|
|
| name | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
| role | string | | No |
|
|
| site | [AppDetailSiteResponse](#appdetailsiteresponse) | | No |
|
|
| tags | [ [Tag](#tag) ] | | No |
|
|
| tracing | | | No |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
| use_icon_as_answer_icon | boolean | | No |
|
|
| workflow | [WorkflowPartial](#workflowpartial) | | No |
|
|
|
|
#### AgentAppFeaturesPayload
|
|
|
|
Presentation features configurable on an Agent App.
|
|
|
|
All fields are optional; an omitted field is reset to its disabled/empty
|
|
default (the config form sends the full desired feature state on save).
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| opening_statement | string | Conversation opener shown before the first turn | No |
|
|
| retriever_resource | [AgentFeatureToggleConfig](#agentfeaturetoggleconfig) | Citations / attributions config, e.g. {'enabled': true} | No |
|
|
| sensitive_word_avoidance | [AgentSensitiveWordAvoidanceFeatureConfig](#agentsensitivewordavoidancefeatureconfig) | Content moderation config | No |
|
|
| speech_to_text | [AgentFeatureToggleConfig](#agentfeaturetoggleconfig) | Speech-to-text config | No |
|
|
| suggested_questions | [ string ] | Preset questions shown alongside the opener | No |
|
|
| suggested_questions_after_answer | [AgentSuggestedQuestionsAfterAnswerFeatureConfig](#agentsuggestedquestionsafteranswerfeatureconfig) | Follow-up suggestions config, e.g. {'enabled': true} | No |
|
|
| text_to_speech | [AgentTextToSpeechFeatureConfig](#agenttexttospeechfeatureconfig) | Text-to-speech config | No |
|
|
|
|
#### AgentAppPagination
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AgentAppPartial](#agentapppartial) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### AgentAppPartial
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_mode | string | | No |
|
|
| active_config_is_published | boolean | | No |
|
|
| app_id | string | | No |
|
|
| author_name | string | | No |
|
|
| backing_app_id | string | | No |
|
|
| bound_agent_id | string | | No |
|
|
| create_user_name | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| debug_conversation_id | string | | No |
|
|
| description | string | | No |
|
|
| has_draft_trigger | boolean | | No |
|
|
| hidden_app_backed | boolean | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| icon_url | string | | Yes |
|
|
| id | string | | Yes |
|
|
| is_starred | boolean | | No |
|
|
| maintainer | string | | No |
|
|
| max_active_requests | integer | | No |
|
|
| mode | string | | Yes |
|
|
| model_config | [ModelConfigPartial](#modelconfigpartial) | | No |
|
|
| name | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
| published_reference_count | integer | | No |
|
|
| published_references | [ [AgentAppPublishedReferenceResponse](#agentapppublishedreferenceresponse) ] | | No |
|
|
| reference_count | integer | | No |
|
|
| role | string | | No |
|
|
| tags | [ [Tag](#tag) ] | | No |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
| use_icon_as_answer_icon | boolean | | No |
|
|
| workflow | [WorkflowPartial](#workflowpartial) | | No |
|
|
|
|
#### AgentAppPublishedReferenceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_icon | string | | No |
|
|
| app_icon_background | string | | No |
|
|
| app_icon_type | string | | No |
|
|
| app_id | string | | Yes |
|
|
| app_name | string | | Yes |
|
|
|
|
#### AgentAppUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | App description (max 400 chars) | No |
|
|
| icon | string | Icon | No |
|
|
| icon_background | string | Icon background color | No |
|
|
| icon_type | [IconType](#icontype) | Icon type | No |
|
|
| max_active_requests | integer | Maximum active requests | No |
|
|
| name | string | App name | Yes |
|
|
| role | string | Agent role | No |
|
|
| use_icon_as_answer_icon | boolean | Use icon as answer icon | No |
|
|
|
|
#### AgentAudioTranscriptFormPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| draft_type | [AgentConfigDraftType](#agentconfigdrafttype) | | No |
|
|
|
|
#### AgentAverageResponseTimeStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| latency | number | | Yes |
|
|
|
|
#### AgentAverageSessionInteractionStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| interactions | number | | Yes |
|
|
|
|
#### AgentBuildDraftApplyResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| draft | object | | Yes |
|
|
| result | string | | Yes |
|
|
|
|
#### AgentBuildDraftCheckoutPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| force | boolean | Overwrite the existing current-user build draft | No |
|
|
|
|
#### AgentBuildDraftResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_soul | [AgentSoulConfig](#agentsoulconfig) | | Yes |
|
|
| draft | [AgentConfigDraftSummaryResponse](#agentconfigdraftsummaryresponse) | | Yes |
|
|
| variant | string | | Yes |
|
|
|
|
#### AgentCliToolAuthorizationStatus
|
|
|
|
Authorization state for Agent-scoped CLI tools.
|
|
|
|
Missing status keeps backward compatibility with draft rows and CLI tools that
|
|
do not need pre-authorization. Explicit denied-like states are blocked by the
|
|
composer/publish validators and skipped by runtime request builders.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AgentCliToolAuthorizationStatus | string | Authorization state for Agent-scoped CLI tools. Missing status keeps backward compatibility with draft rows and CLI tools that do not need pre-authorization. Explicit denied-like states are blocked by the composer/publish validators and skipped by runtime request builders. | |
|
|
|
|
#### AgentCliToolConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| approved | boolean | | No |
|
|
| authorization_status | [AgentCliToolAuthorizationStatus](#agentclitoolauthorizationstatus) | | No |
|
|
| command | string | | No |
|
|
| dangerous | boolean | | No |
|
|
| dangerous_accepted | boolean | | No |
|
|
| dangerous_acknowledged | boolean | | No |
|
|
| dangerous_command | boolean | | No |
|
|
| description | string | | No |
|
|
| enabled | boolean, <br>**Default:** true | | No |
|
|
| env | [AgentCliToolEnvConfig](#agentclitoolenvconfig) | | No |
|
|
| id | string | | No |
|
|
| inferred_from | string | | No |
|
|
| install | string | | No |
|
|
| install_command | string | | No |
|
|
| install_commands | [ string ] | | No |
|
|
| invoke_metadata | object | | No |
|
|
| label | string | | No |
|
|
| name | string | | No |
|
|
| permission | [AgentPermissionConfig](#agentpermissionconfig) | | No |
|
|
| pre_authorized | boolean | | No |
|
|
| requires_confirmation | boolean | | No |
|
|
| risk_accepted | boolean | | No |
|
|
| risk_level | [AgentCliToolRiskLevel](#agentclitoolrisklevel) | | No |
|
|
| setup_command | string | | No |
|
|
| tool_name | string | | No |
|
|
|
|
#### AgentCliToolEnvConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| secret_refs | [ [AgentSecretRefConfig](#agentsecretrefconfig) ] | | No |
|
|
| variables | [ [AgentEnvVariableConfig](#agentenvvariableconfig) ] | | No |
|
|
|
|
#### AgentCliToolRiskLevel
|
|
|
|
Risk marker for CLI tool bootstrap commands.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AgentCliToolRiskLevel | string | Risk marker for CLI tool bootstrap commands. | |
|
|
|
|
#### AgentComposerAgentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| active_config_snapshot_id | string | | No |
|
|
| app_id | string | | No |
|
|
| backing_app_id | string | | No |
|
|
| description | string | | Yes |
|
|
| hidden_app_backed | boolean | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| role | string | | No |
|
|
| scope | [AgentScope](#agentscope) | | Yes |
|
|
| source | [AgentSource](#agentsource) | | No |
|
|
| status | [AgentStatus](#agentstatus) | | Yes |
|
|
|
|
#### AgentComposerBindingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_id | string | | No |
|
|
| binding_type | [WorkflowAgentBindingType](#workflowagentbindingtype) | | Yes |
|
|
| current_snapshot_id | string | | No |
|
|
| id | string | | Yes |
|
|
| node_id | string | | Yes |
|
|
| workflow_id | string | | Yes |
|
|
|
|
#### AgentComposerCandidatesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allowed_node_job_candidates | [AgentComposerNodeJobCandidatesResponse](#agentcomposernodejobcandidatesresponse) | | No |
|
|
| allowed_soul_candidates | [AgentComposerSoulCandidatesResponse](#agentcomposersoulcandidatesresponse) | | No |
|
|
| capabilities | [ComposerCandidateCapabilities](#composercandidatecapabilities) | | No |
|
|
| truncated | boolean | | No |
|
|
| variant | [ComposerVariant](#composervariant) | | Yes |
|
|
|
|
#### AgentComposerDifyToolCandidateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| granularity | string | | No |
|
|
| id | string | | No |
|
|
| name | string | | No |
|
|
| plugin_id | string | | No |
|
|
| provider | string | | No |
|
|
| provider_id | string | | No |
|
|
| tools_count | integer | | No |
|
|
|
|
#### AgentComposerImpactBindingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string | | Yes |
|
|
| node_id | string | | Yes |
|
|
| workflow_id | string | | Yes |
|
|
|
|
#### AgentComposerImpactResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| bindings | [ [AgentComposerImpactBindingResponse](#agentcomposerimpactbindingresponse) ] | | No |
|
|
| current_snapshot_id | string | | No |
|
|
| workflow_node_count | integer | | Yes |
|
|
|
|
#### AgentComposerKnowledgeDatasetCandidateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| id | string | | No |
|
|
| missing | boolean | | No |
|
|
| name | string | | No |
|
|
|
|
#### AgentComposerKnowledgeSetCandidateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| datasets | [ [AgentComposerKnowledgeDatasetCandidateResponse](#agentcomposerknowledgedatasetcandidateresponse) ] | | No |
|
|
| description | string | | No |
|
|
| id | string | | Yes |
|
|
| missing_dataset_ids | [ string ] | | No |
|
|
| name | string | | Yes |
|
|
|
|
#### AgentComposerNodeJobCandidatesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| declare_output_types | [ [DeclaredOutputType](#declaredoutputtype) ] | | No |
|
|
| human_contacts | [ [AgentHumanContactConfig](#agenthumancontactconfig) ] | | No |
|
|
| previous_node_outputs | [ [WorkflowPreviousNodeOutputRef](#workflowpreviousnodeoutputref) ] | | No |
|
|
|
|
#### AgentComposerSoulCandidatesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cli_tools | [ [AgentCliToolConfig](#agentclitoolconfig) ] | | No |
|
|
| dify_tools | [ [AgentComposerDifyToolCandidateResponse](#agentcomposerdifytoolcandidateresponse) ] | | No |
|
|
| human_contacts | [ [AgentHumanContactConfig](#agenthumancontactconfig) ] | | No |
|
|
| knowledge_sets | [ [AgentComposerKnowledgeSetCandidateResponse](#agentcomposerknowledgesetcandidateresponse) ] | | No |
|
|
|
|
#### AgentComposerSoulLockResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| can_unlock | boolean | | No |
|
|
| locked | boolean | | Yes |
|
|
| reason | string | | No |
|
|
|
|
#### AgentComposerValidateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| errors | [ string ] | | No |
|
|
| knowledge_retrieval_placeholder | [ [ComposerKnowledgePlaceholderResponse](#composerknowledgeplaceholderresponse) ] | | No |
|
|
| result | string | | Yes |
|
|
| warnings | [ [ComposerValidationWarningResponse](#composervalidationwarningresponse) ] | | No |
|
|
|
|
#### AgentConfigDeleteResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| removed_names | [ string ] | | No |
|
|
| result | string | | Yes |
|
|
|
|
#### AgentConfigDownloadResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| url | string | | Yes |
|
|
|
|
#### AgentConfigDraftSummaryResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| account_id | string | | No |
|
|
| agent_id | string | | Yes |
|
|
| base_snapshot_id | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| draft_type | [AgentConfigDraftType](#agentconfigdrafttype) | | Yes |
|
|
| id | string | | Yes |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
|
|
#### AgentConfigDraftType
|
|
|
|
Editable Agent Soul draft workspace type.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AgentConfigDraftType | string | Editable Agent Soul draft workspace type. | |
|
|
|
|
#### AgentConfigFileItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| file_id | string | | No |
|
|
| hash | string | | No |
|
|
| id | string | | Yes |
|
|
| is_missing | boolean | | No |
|
|
| mime_type | string | | No |
|
|
| name | string | | Yes |
|
|
| size | integer | | No |
|
|
|
|
#### AgentConfigFileItemsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [AgentConfigFileItemResponse](#agentconfigfileitemresponse) ] | | No |
|
|
|
|
#### AgentConfigFileListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_id | string | | Yes |
|
|
| config_version | [AgentConfigVersionResponse](#agentconfigversionresponse) | | Yes |
|
|
| items | [ [AgentConfigFileItemResponse](#agentconfigfileitemresponse) ] | | No |
|
|
|
|
#### AgentConfigFilePreviewResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| binary | boolean | | Yes |
|
|
| name | string | | Yes |
|
|
| size | integer | | No |
|
|
| text | string | | No |
|
|
| truncated | boolean | | Yes |
|
|
|
|
#### AgentConfigFileRefConfig
|
|
|
|
Stable Agent Soul reference to one config file payload.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| file_id | string | | No |
|
|
| file_kind | string, <br>**Available values:** "tool_file", "upload_file" | *Enum:* `"tool_file"`, `"upload_file"` | Yes |
|
|
| hash | string | | No |
|
|
| is_missing | boolean | | No |
|
|
| mime_type | string | | No |
|
|
| name | string | | Yes |
|
|
| size | integer | | No |
|
|
|
|
#### AgentConfigFileUploadPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| upload_file_id | string | UploadFile UUID from POST /console/api/files/upload | Yes |
|
|
|
|
#### AgentConfigFileUploadResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| config_version | [AgentConfigVersionResponse](#agentconfigversionresponse) | | Yes |
|
|
| file | [AgentConfigFileItemResponse](#agentconfigfileitemresponse) | | Yes |
|
|
|
|
#### AgentConfigManifestResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_id | string | | Yes |
|
|
| config_version | [AgentConfigVersionResponse](#agentconfigversionresponse) | | Yes |
|
|
| env_keys | [ string ] | | No |
|
|
| files | [AgentConfigFileItemsResponse](#agentconfigfileitemsresponse) | | No |
|
|
| note | string | | No |
|
|
| skills | [AgentConfigSkillItemsResponse](#agentconfigskillitemsresponse) | | No |
|
|
|
|
#### AgentConfigRevisionOperation
|
|
|
|
Audit operation recorded for Agent Soul version/revision changes.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AgentConfigRevisionOperation | string | Audit operation recorded for Agent Soul version/revision changes. | |
|
|
|
|
#### AgentConfigRevisionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| current_snapshot_id | string | | Yes |
|
|
| id | string | | Yes |
|
|
| operation | [AgentConfigRevisionOperation](#agentconfigrevisionoperation) | | Yes |
|
|
| previous_snapshot_id | string | | No |
|
|
| revision | integer | | Yes |
|
|
| summary | string | | No |
|
|
| version_note | string | | No |
|
|
|
|
#### AgentConfigSkillFilePreviewResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| binary | boolean | | Yes |
|
|
| path | string | | Yes |
|
|
| size | integer | | No |
|
|
| text | string | | No |
|
|
| truncated | boolean | | Yes |
|
|
|
|
#### AgentConfigSkillFileResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| downloadable | boolean | | Yes |
|
|
| name | string | | Yes |
|
|
| path | string | | Yes |
|
|
| previewable | boolean | | Yes |
|
|
| type | string, <br>**Available values:** "directory", "file" | *Enum:* `"directory"`, `"file"` | Yes |
|
|
|
|
#### AgentConfigSkillInspectResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| file_tree | [ object ] | | No |
|
|
| files | [ [AgentConfigSkillFileResponse](#agentconfigskillfileresponse) ] | | No |
|
|
| hash | string | | No |
|
|
| id | string | | Yes |
|
|
| mime_type | string | | No |
|
|
| name | string | | Yes |
|
|
| size | integer | | No |
|
|
| skill_md | [AgentConfigSkillMarkdownResponse](#agentconfigskillmarkdownresponse) | | Yes |
|
|
| source | string | | Yes |
|
|
| warnings | [ string ] | | No |
|
|
|
|
#### AgentConfigSkillItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| file_id | string | | No |
|
|
| hash | string | | No |
|
|
| id | string | | Yes |
|
|
| is_missing | boolean | | No |
|
|
| mime_type | string | | No |
|
|
| name | string | | Yes |
|
|
| size | integer | | No |
|
|
|
|
#### AgentConfigSkillItemsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [AgentConfigSkillItemResponse](#agentconfigskillitemresponse) ] | | No |
|
|
|
|
#### AgentConfigSkillListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_id | string | | Yes |
|
|
| config_version | [AgentConfigVersionResponse](#agentconfigversionresponse) | | Yes |
|
|
| items | [ [AgentConfigSkillItemResponse](#agentconfigskillitemresponse) ] | | No |
|
|
|
|
#### AgentConfigSkillMarkdownResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| binary | boolean | | Yes |
|
|
| path | string | | Yes |
|
|
| size | integer | | No |
|
|
| text | string | | Yes |
|
|
| truncated | boolean | | Yes |
|
|
|
|
#### AgentConfigSkillRefConfig
|
|
|
|
Stable Agent Soul reference to one normalized skill archive.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| file_id | string | | No |
|
|
| file_kind | string, <br>**Default:** tool_file | | No |
|
|
| hash | string | | No |
|
|
| is_missing | boolean | | No |
|
|
| mime_type | string | | No |
|
|
| name | string | | Yes |
|
|
| size | integer | | No |
|
|
|
|
#### AgentConfigSkillUploadResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| config_version | [AgentConfigVersionResponse](#agentconfigversionresponse) | | Yes |
|
|
| skill | [AgentConfigSkillItemResponse](#agentconfigskillitemresponse) | | Yes |
|
|
|
|
#### AgentConfigSnapshotDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_id | string | | No |
|
|
| config_snapshot | [AgentSoulConfig](#agentsoulconfig) | | Yes |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| display_version | integer | | No |
|
|
| id | string | | Yes |
|
|
| revisions | [ [AgentConfigRevisionResponse](#agentconfigrevisionresponse) ] | | No |
|
|
| snapshot_version | integer | | No |
|
|
| summary | string | | No |
|
|
| version | integer | | Yes |
|
|
| version_note | string | | No |
|
|
|
|
#### AgentConfigSnapshotListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AgentConfigSnapshotSummaryResponse](#agentconfigsnapshotsummaryresponse) ] | | Yes |
|
|
|
|
#### AgentConfigSnapshotRestoreResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| active_config_snapshot_id | string | | Yes |
|
|
| draft_config_id | string | | No |
|
|
| restored_version_id | string | | No |
|
|
| result | string | | Yes |
|
|
|
|
#### AgentConfigSnapshotSummaryResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_id | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| display_version | integer | | No |
|
|
| id | string | | Yes |
|
|
| snapshot_version | integer | | No |
|
|
| summary | string | | No |
|
|
| version | integer | | Yes |
|
|
| version_note | string | | No |
|
|
|
|
#### AgentConfigVersionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| kind | string, <br>**Available values:** "build_draft", "draft", "snapshot" | *Enum:* `"build_draft"`, `"draft"`, `"snapshot"` | Yes |
|
|
| writable | boolean | | Yes |
|
|
|
|
#### AgentDailyConversationStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_count | integer | | Yes |
|
|
| date | string | | Yes |
|
|
|
|
#### AgentDailyEndUserStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| terminal_count | integer | | Yes |
|
|
|
|
#### AgentDailyMessageStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| message_count | integer | | Yes |
|
|
|
|
#### AgentDebugConversationRefreshPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| draft_type | [AgentConfigDraftType](#agentconfigdrafttype) | Agent draft surface whose conversation should be refreshed | No |
|
|
|
|
#### AgentDebugConversationRefreshResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| debug_conversation_has_messages | boolean | | No |
|
|
| debug_conversation_id | string | | Yes |
|
|
| debug_conversation_message_count | integer | | No |
|
|
|
|
#### AgentDriveDeleteFileByAgentQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| key | string | Drive key, e.g. files/sample.pdf | Yes |
|
|
|
|
#### AgentDriveDeleteResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| removed_keys | [ string ] | | No |
|
|
| result | string | | Yes |
|
|
|
|
#### AgentDriveDownloadResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| url | string | | Yes |
|
|
|
|
#### AgentDriveFileCommitResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| file | [AgentDriveFileResponse](#agentdrivefileresponse) | | Yes |
|
|
|
|
#### AgentDriveFilePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| upload_file_id | string | UploadFile UUID from POST /console/api/files/upload | Yes |
|
|
|
|
#### AgentDriveFileResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| drive_key | string | | Yes |
|
|
| file_id | string | | Yes |
|
|
| mime_type | string | | No |
|
|
| name | string | | Yes |
|
|
| size | integer | | No |
|
|
|
|
#### AgentDriveItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| file_kind | string | | Yes |
|
|
| hash | string | | No |
|
|
| is_skill | boolean | | No |
|
|
| key | string | | Yes |
|
|
| mime_type | string | | No |
|
|
| size | integer | | No |
|
|
| skill_metadata | string | | No |
|
|
|
|
#### AgentDriveListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [AgentDriveItemResponse](#agentdriveitemresponse) ] | | No |
|
|
|
|
#### AgentDrivePreviewResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| binary | boolean | | Yes |
|
|
| key | string | | Yes |
|
|
| size | integer | | No |
|
|
| text | string | | No |
|
|
| truncated | boolean | | Yes |
|
|
|
|
#### AgentDriveSkillFileResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| available_in_drive | boolean | | Yes |
|
|
| drive_key | string | | No |
|
|
| name | string | | Yes |
|
|
| path | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### AgentDriveSkillInspectResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| archive_key | string | | No |
|
|
| created_at | integer | | No |
|
|
| description | string | | Yes |
|
|
| file_tree | [ object ] | | No |
|
|
| files | [ [AgentDriveSkillFileResponse](#agentdriveskillfileresponse) ] | | No |
|
|
| hash | string | | No |
|
|
| mime_type | string | | No |
|
|
| name | string | | Yes |
|
|
| path | string | | Yes |
|
|
| size | integer | | No |
|
|
| skill_md | [AgentDriveSkillMarkdownResponse](#agentdriveskillmarkdownresponse) | | Yes |
|
|
| skill_md_key | string | | Yes |
|
|
| source | string | | Yes |
|
|
| warnings | [ string ] | | No |
|
|
|
|
#### AgentDriveSkillItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| archive_key | string | | No |
|
|
| created_at | integer | | No |
|
|
| description | string | | Yes |
|
|
| hash | string | | No |
|
|
| mime_type | string | | No |
|
|
| name | string | | Yes |
|
|
| path | string | | Yes |
|
|
| size | integer | | No |
|
|
| skill_md_key | string | | Yes |
|
|
|
|
#### AgentDriveSkillListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [AgentDriveSkillItemResponse](#agentdriveskillitemresponse) ] | | No |
|
|
|
|
#### AgentDriveSkillMarkdownResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| binary | boolean | | Yes |
|
|
| key | string | | Yes |
|
|
| size | integer | | No |
|
|
| text | string | | No |
|
|
| truncated | boolean | | Yes |
|
|
|
|
#### AgentEnvVariableConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| default | string<br>integer<br>number<br>boolean<br>[ string ]<br>[ integer ]<br>[ number ]<br>[ boolean ] | | No |
|
|
| env_name | string | | No |
|
|
| key | string | | No |
|
|
| name | string | | No |
|
|
| required | boolean | | No |
|
|
| type | string | | No |
|
|
| value | string<br>integer<br>number<br>boolean<br>[ string ]<br>[ integer ]<br>[ number ]<br>[ boolean ] | | No |
|
|
| variable | string | | No |
|
|
|
|
#### AgentFeatureToggleConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | No |
|
|
|
|
#### AgentFileRefConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| drive_key | string | | No |
|
|
| file_id | string | | No |
|
|
| id | string | | No |
|
|
| name | string | | No |
|
|
| reference | string | | No |
|
|
| remote_url | string | | No |
|
|
| tenant_id | string | | No |
|
|
| transfer_method | string | | No |
|
|
| type | string | | No |
|
|
| upload_file_id | string | | No |
|
|
| url | string | | No |
|
|
|
|
#### AgentFileUploadFeatureConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allowed_file_extensions | [ string ] | | No |
|
|
| allowed_file_types | [ [FileType](#filetype) ] | | No |
|
|
| allowed_file_upload_methods | [ [FileTransferMethod](#filetransfermethod) ] | | No |
|
|
| enabled | boolean, <br>**Default:** true | | No |
|
|
| image | [AgentFileUploadImageFeatureConfig](#agentfileuploadimagefeatureconfig) | | No |
|
|
| number_limits | integer, <br>**Default:** 3 | | No |
|
|
|
|
#### AgentFileUploadImageFeatureConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean, <br>**Default:** true | | No |
|
|
|
|
#### AgentHumanContactConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| channel | string | | No |
|
|
| contact_id | string | | No |
|
|
| contact_method | string | | No |
|
|
| email | string | | No |
|
|
| human_id | string | | No |
|
|
| id | string | | No |
|
|
| method | string | | No |
|
|
| name | string | | No |
|
|
| tenant_id | string | | No |
|
|
|
|
#### AgentHumanToolConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| enabled | boolean, <br>**Default:** true | | No |
|
|
| name | string | | No |
|
|
|
|
#### AgentIconType
|
|
|
|
Supported icon storage formats for Agent roster entries.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AgentIconType | string | Supported icon storage formats for Agent roster entries. | |
|
|
|
|
#### AgentIdPath
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_id | string | | Yes |
|
|
|
|
#### AgentInviteOptionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| active_config_is_published | boolean | | No |
|
|
| active_config_snapshot | [AgentConfigSnapshotSummaryResponse](#agentconfigsnapshotsummaryresponse) | | No |
|
|
| active_config_snapshot_id | string | | No |
|
|
| agent_kind | [AgentKind](#agentkind) | | Yes |
|
|
| app_id | string | | No |
|
|
| archived_at | integer | | No |
|
|
| archived_by | string | | No |
|
|
| backing_app_id | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| description | string | | Yes |
|
|
| existing_node_ids | [ string ] | | No |
|
|
| hidden_app_backed | boolean | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | [AgentIconType](#agenticontype) | | No |
|
|
| id | string | | Yes |
|
|
| in_current_workflow_count | integer | | No |
|
|
| is_in_current_workflow | boolean | | No |
|
|
| name | string | | Yes |
|
|
| published_node_reference_count | integer | | No |
|
|
| published_reference_count | integer | | No |
|
|
| published_references | [ [AgentPublishedReferenceResponse](#agentpublishedreferenceresponse) ] | | No |
|
|
| reference_count | integer | | No |
|
|
| role | string | | No |
|
|
| scope | [AgentScope](#agentscope) | | Yes |
|
|
| source | [AgentSource](#agentsource) | | Yes |
|
|
| status | [AgentStatus](#agentstatus) | | Yes |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
| workflow_id | string | | No |
|
|
| workflow_node_id | string | | No |
|
|
|
|
#### AgentInviteOptionsQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string | Workflow app id for in-current-workflow markers | No |
|
|
| keyword | string | | No |
|
|
| limit | integer, <br>**Default:** 20 | | No |
|
|
| page | integer, <br>**Default:** 1 | | No |
|
|
|
|
#### AgentInviteOptionsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AgentInviteOptionResponse](#agentinviteoptionresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### AgentIterationLogResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | string | | Yes |
|
|
| files | [ ] | | No |
|
|
| thought | string | | No |
|
|
| tokens | integer | | Yes |
|
|
| tool_calls | [ [AgentToolCallResponse](#agenttoolcallresponse) ] | | Yes |
|
|
| tool_raw | object | | Yes |
|
|
|
|
#### AgentKind
|
|
|
|
Agent implementation family.
|
|
|
|
This leaves room for future non-Dify agent implementations while keeping
|
|
the current roster/workflow APIs scoped to Dify Agent.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AgentKind | string | Agent implementation family. This leaves room for future non-Dify agent implementations while keeping the current roster/workflow APIs scoped to Dify Agent. | |
|
|
|
|
#### AgentKnowledgeDatasetConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| id | string | | No |
|
|
| name | string | | No |
|
|
|
|
#### AgentKnowledgeMetadataCondition
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| comparison_operator | string, <br>**Available values:** "<", "=", ">", "after", "before", "contains", "empty", "end with", "in", "is", "is not", "not contains", "not empty", "not in", "start with", "≠", "≤", "≥" | *Enum:* `"<"`, `"="`, `">"`, `"after"`, `"before"`, `"contains"`, `"empty"`, `"end with"`, `"in"`, `"is"`, `"is not"`, `"not contains"`, `"not empty"`, `"not in"`, `"start with"`, `"≠"`, `"≤"`, `"≥"` | Yes |
|
|
| name | string | | Yes |
|
|
| value | string<br>[ string ]<br>number | | No |
|
|
|
|
#### AgentKnowledgeMetadataConditions
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conditions | [ [AgentKnowledgeMetadataCondition](#agentknowledgemetadatacondition) ] | | No |
|
|
| logical_operator | string, <br>**Available values:** "and", "or", <br>**Default:** and | *Enum:* `"and"`, `"or"` | No |
|
|
|
|
#### AgentKnowledgeMetadataFilteringConfig
|
|
|
|
Per-set metadata filtering policy.
|
|
|
|
The Python attribute uses ``metadata_model_config`` for clarity because the
|
|
model belongs to metadata filtering specifically, while the external API and
|
|
generated schema keep the historical ``model_config`` field name via alias.
|
|
Mode-dependent completeness is enforced by composer publish validation so
|
|
draft saves can persist partially configured metadata filters.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conditions | [AgentKnowledgeMetadataConditions](#agentknowledgemetadataconditions) | | No |
|
|
| mode | string, <br>**Available values:** "automatic", "disabled", "manual", <br>**Default:** disabled | *Enum:* `"automatic"`, `"disabled"`, `"manual"` | No |
|
|
| model_config | [AgentKnowledgeModelConfig](#agentknowledgemodelconfig) | | No |
|
|
|
|
#### AgentKnowledgeModelConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| completion_params | object | | No |
|
|
| mode | string | | Yes |
|
|
| name | string | | Yes |
|
|
| provider | string | | Yes |
|
|
|
|
#### AgentKnowledgeQueryConfig
|
|
|
|
Per-set query policy for Agent v2 knowledge retrieval.
|
|
|
|
Agent v2 stores knowledge as explicit ``knowledge.sets`` rather than the
|
|
legacy flat ``datasets`` / ``query_mode`` / ``query_config`` shape. Each
|
|
set owns its own query policy. Mode-dependent completeness, such as
|
|
requiring ``value`` for ``user_query``, is enforced by composer publish
|
|
validation so draft saves can persist partially configured knowledge sets.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| mode | [AgentKnowledgeQueryMode](#agentknowledgequerymode) | | Yes |
|
|
| value | string | | No |
|
|
|
|
#### AgentKnowledgeQueryMode
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AgentKnowledgeQueryMode | string | | |
|
|
|
|
#### AgentKnowledgeRerankingModelConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| model | string | | Yes |
|
|
| provider | string | | Yes |
|
|
|
|
#### AgentKnowledgeRetrievalConfig
|
|
|
|
Per-set retrieval policy for Agent v2 knowledge retrieval.
|
|
|
|
Retrieval settings now live on each knowledge set instead of one shared
|
|
flat config. Mode-dependent completeness, such as requiring ``top_k`` for
|
|
``multiple`` or a model for ``single``, is enforced by composer publish
|
|
validation so draft saves can persist partially configured knowledge sets.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| mode | string, <br>**Available values:** "multiple", "single" | *Enum:* `"multiple"`, `"single"` | Yes |
|
|
| model | [AgentKnowledgeModelConfig](#agentknowledgemodelconfig) | | No |
|
|
| reranking_enable | boolean, <br>**Default:** true | | No |
|
|
| reranking_mode | string, <br>**Default:** reranking_model | | No |
|
|
| reranking_model | [AgentKnowledgeRerankingModelConfig](#agentknowledgererankingmodelconfig) | | No |
|
|
| score_threshold | number | | No |
|
|
| top_k | integer | | No |
|
|
| weights | [AgentKnowledgeWeightedScoreConfig](#agentknowledgeweightedscoreconfig) | | No |
|
|
|
|
#### AgentKnowledgeSetConfig
|
|
|
|
One explicit knowledge set in Agent v2.
|
|
|
|
``knowledge.sets`` replaces the old flat knowledge config. Each set owns
|
|
its datasets plus query, retrieval, and metadata policies. An individual
|
|
set must contain at least one dataset id even though the overall knowledge
|
|
section may be empty, which is how callers express "no knowledge layer".
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| datasets | [ [AgentKnowledgeDatasetConfig](#agentknowledgedatasetconfig) ] | | Yes |
|
|
| description | string | | No |
|
|
| id | string | | Yes |
|
|
| metadata_filtering | [AgentKnowledgeMetadataFilteringConfig](#agentknowledgemetadatafilteringconfig) | | No |
|
|
| name | string | | Yes |
|
|
| query | [AgentKnowledgeQueryConfig](#agentknowledgequeryconfig) | | Yes |
|
|
| retrieval | [AgentKnowledgeRetrievalConfig](#agentknowledgeretrievalconfig) | | Yes |
|
|
|
|
#### AgentKnowledgeWeightedScoreConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword_setting | object | | No |
|
|
| vector_setting | object | | No |
|
|
| weight_type | string | | No |
|
|
|
|
#### AgentLogConversationItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_id | string | | Yes |
|
|
| created_at | integer | | No |
|
|
| end_user_id | string | | No |
|
|
| id | string | | Yes |
|
|
| message_count | integer | | Yes |
|
|
| operation_rate | number | | No |
|
|
| source | [AgentLogSourceResponse](#agentlogsourceresponse) | | No |
|
|
| status | string, <br>**Available values:** "failed", "paused", "success" | *Enum:* `"failed"`, `"paused"`, `"success"` | Yes |
|
|
| title | string | | No |
|
|
| unread | boolean | | Yes |
|
|
| updated_at | integer | | No |
|
|
| user_rate | number | | No |
|
|
|
|
#### AgentLogListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AgentLogConversationItemResponse](#agentlogconversationitemresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### AgentLogMessageItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | Yes |
|
|
| answer_tokens | integer | | Yes |
|
|
| conversation_id | string | | Yes |
|
|
| created_at | integer | | No |
|
|
| currency | string | | Yes |
|
|
| error | string | | No |
|
|
| from_account_id | string | | No |
|
|
| from_end_user_id | string | | No |
|
|
| id | string | | Yes |
|
|
| latency | number | | Yes |
|
|
| message_id | string | | Yes |
|
|
| message_tokens | integer | | Yes |
|
|
| query | string | | Yes |
|
|
| status | string | | Yes |
|
|
| total_price | string | | Yes |
|
|
| total_tokens | integer | | Yes |
|
|
| updated_at | integer | | No |
|
|
|
|
#### AgentLogMessageListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AgentLogMessageItemResponse](#agentlogmessageitemresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### AgentLogMetaResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_mode | string | | Yes |
|
|
| elapsed_time | number | | No |
|
|
| executor | string | | Yes |
|
|
| iterations | integer | | Yes |
|
|
| start_time | string | | Yes |
|
|
| status | string | | Yes |
|
|
| total_tokens | integer | | Yes |
|
|
|
|
#### AgentLogQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_id | string | Conversation UUID | Yes |
|
|
| message_id | string | Message UUID | Yes |
|
|
|
|
#### AgentLogResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ ] | | No |
|
|
| iterations | [ [AgentIterationLogResponse](#agentiterationlogresponse) ] | | Yes |
|
|
| meta | [AgentLogMetaResponse](#agentlogmetaresponse) | | Yes |
|
|
|
|
#### AgentLogSourceGroupResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| label | string | | Yes |
|
|
| sources | [ [AgentLogSourceResponse](#agentlogsourceresponse) ] | | No |
|
|
| type | string, <br>**Available values:** "webapp", "workflow" | *Enum:* `"webapp"`, `"workflow"` | Yes |
|
|
|
|
#### AgentLogSourceListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AgentLogSourceResponse](#agentlogsourceresponse) ] | | Yes |
|
|
| groups | [ [AgentLogSourceGroupResponse](#agentlogsourcegroupresponse) ] | | Yes |
|
|
|
|
#### AgentLogSourceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_icon | string | | No |
|
|
| app_icon_background | string | | No |
|
|
| app_icon_type | string | | No |
|
|
| app_id | string | | Yes |
|
|
| app_name | string | | Yes |
|
|
| id | string | | Yes |
|
|
| node_id | string | | No |
|
|
| type | string, <br>**Available values:** "webapp", "workflow" | *Enum:* `"webapp"`, `"workflow"` | Yes |
|
|
| workflow_id | string | | No |
|
|
| workflow_version | string | | No |
|
|
|
|
#### AgentLogsQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| end | string | End date (YYYY-MM-DD HH:MM) | No |
|
|
| keyword | string | Search query, answer, or conversation name | No |
|
|
| limit | integer, <br>**Default:** 20 | Page size | No |
|
|
| page | integer, <br>**Default:** 1 | Page number | No |
|
|
| sort_by | string, <br>**Default:** updated_at | Sort by created_at or updated_at | No |
|
|
| sort_order | string, <br>**Default:** desc | Sort order: asc or desc | No |
|
|
| source | string | Deprecated single source filter | No |
|
|
| sources | [ string ] | Filter by one or more source IDs, e.g. webapp:<app_id> or workflow:<app_id>. Exact workflow:<app_id>:<workflow_id>:<version>:<node_id> IDs remain supported. | No |
|
|
| start | string | Start date (YYYY-MM-DD HH:MM) | No |
|
|
| status | string | Deprecated single status filter | No |
|
|
| statuses | [ string ] | Filter by one or more of success, failed, paused | No |
|
|
|
|
#### AgentMemoryArtifactConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | No |
|
|
| name | string | | No |
|
|
| type | string | | No |
|
|
| url | string | | No |
|
|
|
|
#### AgentModelResponseFormatConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| type | string | | No |
|
|
|
|
#### AgentModerationIOConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | No |
|
|
| preset_response | string | | No |
|
|
|
|
#### AgentModerationProviderConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| api_based_extension_id | string | | No |
|
|
| inputs_config | [AgentModerationIOConfig](#agentmoderationioconfig) | | No |
|
|
| keywords | string | | No |
|
|
| outputs_config | [AgentModerationIOConfig](#agentmoderationioconfig) | | No |
|
|
|
|
#### AgentPermissionConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allowed | boolean | | No |
|
|
| state | string | | No |
|
|
| status | string | | No |
|
|
|
|
#### AgentProviderListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AgentProviderListResponse | array | | |
|
|
|
|
#### AgentProviderResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AgentProviderResponse | object | | |
|
|
|
|
#### AgentPublishPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| version_note | string | Optional note for this published Agent version | No |
|
|
|
|
#### AgentPublishResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| active_config_snapshot | [AgentConfigSnapshotSummaryResponse](#agentconfigsnapshotsummaryresponse) | | No |
|
|
| active_config_snapshot_id | string | | Yes |
|
|
| draft | [AgentConfigDraftSummaryResponse](#agentconfigdraftsummaryresponse) | | No |
|
|
| result | string | | Yes |
|
|
|
|
#### AgentPublishedReferenceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_icon | string | | No |
|
|
| app_icon_background | string | | No |
|
|
| app_icon_type | string | | No |
|
|
| app_id | string | | Yes |
|
|
| app_mode | string | | Yes |
|
|
| app_name | string | | Yes |
|
|
| app_updated_at | integer | | No |
|
|
| node_ids | [ string ] | | No |
|
|
| workflow_id | string | | Yes |
|
|
| workflow_version | string | | Yes |
|
|
|
|
#### AgentReferencingWorkflowResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_icon | string | | No |
|
|
| app_icon_background | string | | No |
|
|
| app_icon_type | string | | No |
|
|
| app_id | string | | Yes |
|
|
| app_mode | string | | Yes |
|
|
| app_name | string | | Yes |
|
|
| app_updated_at | integer | | No |
|
|
| node_ids | [ string ] | | No |
|
|
| workflow_id | string | | Yes |
|
|
| workflow_version | string | | Yes |
|
|
|
|
#### AgentReferencingWorkflowsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AgentReferencingWorkflowResponse](#agentreferencingworkflowresponse) ] | | No |
|
|
|
|
#### AgentRosterListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AgentRosterResponse](#agentrosterresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### AgentRosterResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| active_config_is_published | boolean | | No |
|
|
| active_config_snapshot | [AgentConfigSnapshotSummaryResponse](#agentconfigsnapshotsummaryresponse) | | No |
|
|
| active_config_snapshot_id | string | | No |
|
|
| agent_kind | [AgentKind](#agentkind) | | Yes |
|
|
| app_id | string | | No |
|
|
| archived_at | integer | | No |
|
|
| archived_by | string | | No |
|
|
| backing_app_id | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| description | string | | Yes |
|
|
| hidden_app_backed | boolean | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | [AgentIconType](#agenticontype) | | No |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| published_node_reference_count | integer | | No |
|
|
| published_reference_count | integer | | No |
|
|
| published_references | [ [AgentPublishedReferenceResponse](#agentpublishedreferenceresponse) ] | | No |
|
|
| reference_count | integer | | No |
|
|
| role | string | | No |
|
|
| scope | [AgentScope](#agentscope) | | Yes |
|
|
| source | [AgentSource](#agentsource) | | Yes |
|
|
| status | [AgentStatus](#agentstatus) | | Yes |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
| workflow_id | string | | No |
|
|
| workflow_node_id | string | | No |
|
|
|
|
#### AgentSandboxProviderConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cpu | integer | | No |
|
|
| env | [ [AgentEnvVariableConfig](#agentenvvariableconfig) ] | | No |
|
|
| image | string | | No |
|
|
| working_dir | string | | No |
|
|
|
|
#### AgentSandboxUploadPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_id | string | Agent App conversation ID | Yes |
|
|
| path | string | File path relative to the sandbox workspace | Yes |
|
|
|
|
#### AgentScope
|
|
|
|
Visibility and lifecycle scope of an Agent record.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AgentScope | string | Visibility and lifecycle scope of an Agent record. | |
|
|
|
|
#### AgentSecretRefConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | No |
|
|
| env_name | string | | No |
|
|
| id | string | | No |
|
|
| key | string | | No |
|
|
| name | string | | No |
|
|
| permission | [AgentPermissionConfig](#agentpermissionconfig) | | No |
|
|
| permission_status | string | | No |
|
|
| provider | string | | No |
|
|
| provider_credential_id | string | | No |
|
|
| ref | string | | No |
|
|
| type | string | | No |
|
|
| value | string | | No |
|
|
| variable | string | | No |
|
|
|
|
#### AgentSensitiveWordAvoidanceFeatureConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| config | [AgentModerationProviderConfig](#agentmoderationproviderconfig) | | No |
|
|
| enabled | boolean | | No |
|
|
| type | string | | No |
|
|
|
|
#### AgentSimpleResultResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | | Yes |
|
|
|
|
#### AgentSkillRefConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| file_id | string | | No |
|
|
| full_archive_file_id | string | | No |
|
|
| full_archive_key | string | | No |
|
|
| id | string | | No |
|
|
| manifest_files | [ string ] | | No |
|
|
| name | string | | No |
|
|
| path | string | | No |
|
|
| skill_md_file_id | string | | No |
|
|
| skill_md_key | string | | No |
|
|
|
|
#### AgentSkillUploadResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| manifest | [SkillManifest](#skillmanifest) | | Yes |
|
|
| skill | [AgentUploadedSkillResponse](#agentuploadedskillresponse) | | Yes |
|
|
|
|
#### AgentSoulAppFeaturesConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| file_upload | [AgentFileUploadFeatureConfig](#agentfileuploadfeatureconfig) | | No |
|
|
| opening_statement | string | | No |
|
|
| retriever_resource | [AgentFeatureToggleConfig](#agentfeaturetoggleconfig) | | No |
|
|
| sensitive_word_avoidance | [AgentSensitiveWordAvoidanceFeatureConfig](#agentsensitivewordavoidancefeatureconfig) | | No |
|
|
| speech_to_text | [AgentFeatureToggleConfig](#agentfeaturetoggleconfig) | | No |
|
|
| suggested_questions | [ string ] | | No |
|
|
| suggested_questions_after_answer | [AgentSuggestedQuestionsAfterAnswerFeatureConfig](#agentsuggestedquestionsafteranswerfeatureconfig) | | No |
|
|
| text_to_speech | [AgentTextToSpeechFeatureConfig](#agenttexttospeechfeatureconfig) | | No |
|
|
|
|
#### AgentSoulConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_features | [AgentSoulAppFeaturesConfig](#agentsoulappfeaturesconfig) | | No |
|
|
| app_variables | [ [AppVariableConfig](#appvariableconfig) ] | | No |
|
|
| config_files | [ [AgentConfigFileRefConfig](#agentconfigfilerefconfig) ] | | No |
|
|
| config_note | string | | No |
|
|
| config_skills | [ [AgentConfigSkillRefConfig](#agentconfigskillrefconfig) ] | | No |
|
|
| env | [AgentSoulEnvConfig](#agentsoulenvconfig) | | No |
|
|
| files | [AgentSoulFilesConfig](#agentsoulfilesconfig) | | No |
|
|
| human | [AgentSoulHumanConfig](#agentsoulhumanconfig) | | No |
|
|
| knowledge | [AgentSoulKnowledgeConfig](#agentsoulknowledgeconfig) | | No |
|
|
| memory | [AgentSoulMemoryConfig](#agentsoulmemoryconfig) | | No |
|
|
| misc_legacy | [AgentSoulAppFeaturesConfig](#agentsoulappfeaturesconfig) | | No |
|
|
| model | [AgentSoulModelConfig](#agentsoulmodelconfig) | | No |
|
|
| prompt | [AgentSoulPromptConfig](#agentsoulpromptconfig) | | No |
|
|
| sandbox | [AgentSoulSandboxConfig](#agentsoulsandboxconfig) | | No |
|
|
| schema_version | integer, <br>**Default:** 1 | | No |
|
|
| tools | [AgentSoulToolsConfig](#agentsoultoolsconfig) | | No |
|
|
|
|
#### AgentSoulDifyToolConfig
|
|
|
|
One Dify tool configured on Agent Soul.
|
|
|
|
The API backend prepares this persisted product shape into
|
|
either ``DifyPluginToolConfig`` or ``DifyCoreToolConfig`` before sending a
|
|
run request to Agent backend. ``plugin`` providers keep the direct
|
|
``dify.plugin.tools`` transport; ``builtin`` / ``api`` / ``workflow`` /
|
|
``mcp`` providers are prepared for ``dify.core.tools``. ``provider_id``
|
|
keeps compatibility with existing Agent tool config payloads; new callers
|
|
should send ``plugin_id`` + ``provider`` when available.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_ref | [AgentSoulDifyToolCredentialRef](#agentsouldifytoolcredentialref) | | No |
|
|
| credential_type | string, <br>**Available values:** "api-key", "oauth2", "unauthorized", <br>**Default:** api-key | *Enum:* `"api-key"`, `"oauth2"`, `"unauthorized"` | No |
|
|
| description | string | | No |
|
|
| enabled | boolean, <br>**Default:** true | | No |
|
|
| name | string | | No |
|
|
| plugin_id | string | | No |
|
|
| provider | string | | No |
|
|
| provider_id | string | | No |
|
|
| provider_type | [ToolProviderType](#toolprovidertype) | | Yes |
|
|
| runtime_parameters | object | | No |
|
|
| tool_name | string | | No |
|
|
|
|
#### AgentSoulDifyToolCredentialRef
|
|
|
|
Reference to a stored Dify Plugin Tool credential.
|
|
|
|
Secret values are resolved only at runtime. The legacy ``credential_id``
|
|
field is accepted by :class:`AgentSoulDifyToolConfig` and normalized here so
|
|
old Agent tool payloads can be read while new payloads stay explicit.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | No |
|
|
| provider | string | | No |
|
|
| type | string, <br>**Available values:** "provider", "tool", <br>**Default:** tool | *Enum:* `"provider"`, `"tool"` | No |
|
|
|
|
#### AgentSoulEnvConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| secret_refs | [ [AgentSecretRefConfig](#agentsecretrefconfig) ] | | No |
|
|
| variables | [ [AgentEnvVariableConfig](#agentenvvariableconfig) ] | | No |
|
|
|
|
#### AgentSoulFilesConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ [AgentFileRefConfig](#agentfilerefconfig) ] | | No |
|
|
| skills | [ [AgentSkillRefConfig](#agentskillrefconfig) ] | | No |
|
|
|
|
#### AgentSoulHumanConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| contacts | [ [AgentHumanContactConfig](#agenthumancontactconfig) ] | | No |
|
|
| tools | [ [AgentHumanToolConfig](#agenthumantoolconfig) ] | | No |
|
|
|
|
#### AgentSoulKnowledgeConfig
|
|
|
|
Top-level Agent v2 knowledge config.
|
|
|
|
Agent v2 models knowledge as explicit sets instead of one flat
|
|
``datasets`` / ``query_mode`` / ``query_config`` block. An empty ``sets``
|
|
list means no knowledge layer should be emitted at runtime, while set-name
|
|
uniqueness stays case-insensitive because runtime selection addresses sets
|
|
by name.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| sets | [ [AgentKnowledgeSetConfig](#agentknowledgesetconfig) ] | | No |
|
|
|
|
#### AgentSoulMemoryConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| artifacts | [ [AgentMemoryArtifactConfig](#agentmemoryartifactconfig) ] | | No |
|
|
| budget | string | | No |
|
|
| scope | string | | No |
|
|
|
|
#### AgentSoulModelConfig
|
|
|
|
Stable model selection for Agent runtime without storing secret values.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_ref | [AgentSoulModelCredentialRef](#agentsoulmodelcredentialref) | | No |
|
|
| model | string | | Yes |
|
|
| model_provider | string | | Yes |
|
|
| model_settings | [AgentSoulModelSettings](#agentsoulmodelsettings) | | No |
|
|
| plugin_id | string | | Yes |
|
|
|
|
#### AgentSoulModelCredentialRef
|
|
|
|
Reference to model credentials resolved only at runtime.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | No |
|
|
| provider | string | | No |
|
|
| type | string | | Yes |
|
|
|
|
#### AgentSoulModelSettings
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| frequency_penalty | number | | No |
|
|
| max_tokens | integer | | No |
|
|
| presence_penalty | number | | No |
|
|
| response_format | [AgentModelResponseFormatConfig](#agentmodelresponseformatconfig) | | No |
|
|
| stop | [ string ] | | No |
|
|
| temperature | number | | No |
|
|
| top_p | number | | No |
|
|
|
|
#### AgentSoulPromptConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| system_prompt | string | | No |
|
|
|
|
#### AgentSoulSandboxConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| config | [AgentSandboxProviderConfig](#agentsandboxproviderconfig) | | No |
|
|
| provider | string | | No |
|
|
|
|
#### AgentSoulToolsConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cli_tools | [ [AgentCliToolConfig](#agentclitoolconfig) ] | | No |
|
|
| dify_tools | [ [AgentSoulDifyToolConfig](#agentsouldifytoolconfig) ] | | No |
|
|
|
|
#### AgentSource
|
|
|
|
Origin that created or imported the Agent.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AgentSource | string | Origin that created or imported the Agent. | |
|
|
|
|
#### AgentStatisticChartsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| average_response_time | [ [AgentAverageResponseTimeStatisticResponse](#agentaverageresponsetimestatisticresponse) ] | | No |
|
|
| average_session_interactions | [ [AgentAverageSessionInteractionStatisticResponse](#agentaveragesessioninteractionstatisticresponse) ] | | No |
|
|
| daily_conversations | [ [AgentDailyConversationStatisticResponse](#agentdailyconversationstatisticresponse) ] | | No |
|
|
| daily_end_users | [ [AgentDailyEndUserStatisticResponse](#agentdailyenduserstatisticresponse) ] | | No |
|
|
| daily_messages | [ [AgentDailyMessageStatisticResponse](#agentdailymessagestatisticresponse) ] | | No |
|
|
| token_usage | [ [AgentTokenUsageStatisticResponse](#agenttokenusagestatisticresponse) ] | | No |
|
|
| tokens_per_second | [ [AgentTokensPerSecondStatisticResponse](#agenttokenspersecondstatisticresponse) ] | | No |
|
|
| user_satisfaction_rate | [ [AgentUserSatisfactionRateStatisticResponse](#agentusersatisfactionratestatisticresponse) ] | | No |
|
|
|
|
#### AgentStatisticSummaryEnvelopeResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| charts | [AgentStatisticChartsResponse](#agentstatisticchartsresponse) | | Yes |
|
|
| source | string | | Yes |
|
|
| summary | [AgentStatisticSummaryResponse](#agentstatisticsummaryresponse) | | Yes |
|
|
|
|
#### AgentStatisticSummaryResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| average_response_time | number | | Yes |
|
|
| average_session_interactions | number | | Yes |
|
|
| currency | string | | Yes |
|
|
| tokens_per_second | number | | Yes |
|
|
| total_conversations | integer | | Yes |
|
|
| total_end_users | integer | | Yes |
|
|
| total_messages | integer | | Yes |
|
|
| total_price | string | | Yes |
|
|
| total_tokens | integer | | Yes |
|
|
| user_satisfaction_rate | number | | Yes |
|
|
|
|
#### AgentStatisticsQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| end | string | End date (YYYY-MM-DD HH:MM) | No |
|
|
| source | string | Filter by a structured webapp:<app_id> or workflow:<app_id> source ID. Legacy invoke sources and exact workflow version/node source IDs remain supported. | No |
|
|
| start | string | Start date (YYYY-MM-DD HH:MM) | No |
|
|
|
|
#### AgentStatus
|
|
|
|
Soft lifecycle state for Agent records.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AgentStatus | string | Soft lifecycle state for Agent records. | |
|
|
|
|
#### AgentStrategyProviderEntity
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| identity | [AgentStrategyProviderIdentity](#agentstrategyprovideridentity) | | Yes |
|
|
| plugin_id | string | The id of the plugin | No |
|
|
|
|
#### AgentStrategyProviderIdentity
|
|
|
|
Inherits from ToolProviderIdentity, without any additional fields.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| author | string | The author of the tool | Yes |
|
|
| description | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | The description of the tool | Yes |
|
|
| icon | string | The icon of the tool | Yes |
|
|
| icon_dark | string | The dark icon of the tool | No |
|
|
| label | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | The label of the tool | Yes |
|
|
| name | string | The name of the tool | Yes |
|
|
| tags | [ [ToolLabelEnum](#toollabelenum) ] | The tags of the tool | No |
|
|
|
|
#### AgentSuggestedQuestionsAfterAnswerFeatureConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | No |
|
|
| model | [AgentSuggestedQuestionsAfterAnswerModelConfig](#agentsuggestedquestionsafteranswermodelconfig) | | No |
|
|
| prompt | string | | No |
|
|
|
|
#### AgentSuggestedQuestionsAfterAnswerModelConfig
|
|
|
|
Legacy Chat App model config used only for follow-up question generation.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| completion_params | object | | No |
|
|
| mode | string | | No |
|
|
| name | string | | Yes |
|
|
| provider | string | | Yes |
|
|
|
|
#### AgentTextToSpeechFeatureConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| autoPlay | string | | No |
|
|
| enabled | boolean | | No |
|
|
| language | string | | No |
|
|
| voice | string | | No |
|
|
|
|
#### AgentThought
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | No |
|
|
| chain_id | string | | No |
|
|
| created_at | integer | | No |
|
|
| files | [ string ] | | Yes |
|
|
| id | string | | Yes |
|
|
| message_id | string | | Yes |
|
|
| observation | string | | No |
|
|
| position | integer | | Yes |
|
|
| thought | string | | No |
|
|
| tool | string | | No |
|
|
| tool_input | string | | No |
|
|
| tool_labels | [JSONValue](#jsonvalue) | | Yes |
|
|
|
|
#### AgentTokenUsageStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| currency | string | | Yes |
|
|
| date | string | | Yes |
|
|
| token_count | integer | | Yes |
|
|
| total_price | string | | Yes |
|
|
|
|
#### AgentTokensPerSecondStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| tps | number | | Yes |
|
|
|
|
#### AgentToolCallResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| error | string | | No |
|
|
| status | string | | Yes |
|
|
| time_cost | number<br>integer | | Yes |
|
|
| tool_icon | | | No |
|
|
| tool_input | object | | Yes |
|
|
| tool_label | string | | Yes |
|
|
| tool_name | string | | Yes |
|
|
| tool_output | object | | Yes |
|
|
| tool_parameters | object | | Yes |
|
|
|
|
#### AgentUploadedSkillResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| archive_key | string | | No |
|
|
| description | string | | Yes |
|
|
| name | string | | Yes |
|
|
| path | string | | Yes |
|
|
| skill_md_key | string | | Yes |
|
|
|
|
#### AgentUserSatisfactionRateStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| rate | number | | Yes |
|
|
|
|
#### AllowedExtensionsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allowed_extensions | [ string ] | | Yes |
|
|
|
|
#### Annotation
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | No |
|
|
| created_at | integer | | No |
|
|
| hit_count | integer | | No |
|
|
| id | string | | Yes |
|
|
| question | string | | No |
|
|
|
|
#### AnnotationBatchImportResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| error_msg | string | | No |
|
|
| job_id | string | | No |
|
|
| job_status | string | | No |
|
|
| record_count | integer | | No |
|
|
|
|
#### AnnotationCountResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| count | integer | Number of annotations | Yes |
|
|
|
|
#### AnnotationExportList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [Annotation](#annotation) ] | | Yes |
|
|
|
|
#### AnnotationFilePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| message_id | string | Message ID | Yes |
|
|
|
|
#### AnnotationHitHistory
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| id | string | | Yes |
|
|
| match | string | | No |
|
|
| question | string | | No |
|
|
| response | string | | No |
|
|
| score | number | | No |
|
|
| source | string | | No |
|
|
|
|
#### AnnotationHitHistoryList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AnnotationHitHistory](#annotationhithistory) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### AnnotationHitHistoryListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| limit | integer, <br>**Default:** 20 | Page size | No |
|
|
| page | integer, <br>**Default:** 1 | Page number | No |
|
|
|
|
#### AnnotationJobStatusDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| error_msg | string | | No |
|
|
| job_id | string | | Yes |
|
|
| job_status | string<br>string | | Yes |
|
|
|
|
#### AnnotationJobStatusResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| job_id | string | | Yes |
|
|
| job_status | string<br>string | | Yes |
|
|
|
|
#### AnnotationList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [Annotation](#annotation) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### AnnotationListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword | string | Search keyword | No |
|
|
| limit | integer, <br>**Default:** 20 | Page size | No |
|
|
| page | integer, <br>**Default:** 1 | Page number | No |
|
|
|
|
#### AnnotationReplyPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| embedding_model_name | string | Embedding model name | Yes |
|
|
| embedding_provider_name | string | Embedding provider name | Yes |
|
|
| score_threshold | number | Score threshold for annotation matching | Yes |
|
|
|
|
#### AnnotationReplyStatusQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| action | string, <br>**Available values:** "disable", "enable" | *Enum:* `"disable"`, `"enable"` | Yes |
|
|
|
|
#### AnnotationSettingEmbeddingModelResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| embedding_model_name | string | | No |
|
|
| embedding_provider_name | string | | No |
|
|
|
|
#### AnnotationSettingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| embedding_model | [AnnotationSettingEmbeddingModelResponse](#annotationsettingembeddingmodelresponse) | | No |
|
|
| enabled | boolean | | Yes |
|
|
| id | string | | No |
|
|
| score_threshold | number | | No |
|
|
|
|
#### AnnotationSettingUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| score_threshold | number | Score threshold | Yes |
|
|
|
|
#### ApiBaseUrlResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| api_base_url | string | | Yes |
|
|
|
|
#### ApiKeyAuthBindingPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| category | string | | Yes |
|
|
| credentials | object | | Yes |
|
|
| provider | string | | Yes |
|
|
|
|
#### ApiKeyAuthDataSourceItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| category | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| disabled | boolean | | Yes |
|
|
| id | string | | Yes |
|
|
| provider | string | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
|
|
#### ApiKeyAuthDataSourceListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| sources | [ [ApiKeyAuthDataSourceItem](#apikeyauthdatasourceitem) ] | | Yes |
|
|
|
|
#### ApiKeyItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| id | string | | Yes |
|
|
| last_used_at | integer | | No |
|
|
| token | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### ApiKeyList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ApiKeyItem](#apikeyitem) ] | | Yes |
|
|
|
|
#### ApiProviderDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | object | | No |
|
|
| custom_disclaimer | string | | No |
|
|
| description | string | | No |
|
|
| icon | [ToolEmojiIcon](#toolemojiicon) | | Yes |
|
|
| labels | [ string ] | | No |
|
|
| privacy_policy | string | | No |
|
|
| schema | string | | Yes |
|
|
| schema_type | [ApiProviderSchemaType](#apiproviderschematype) | | Yes |
|
|
| tools | [ [ApiToolBundle](#apitoolbundle) ] | | Yes |
|
|
|
|
#### ApiProviderRemoteSchemaResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| schema | string | | Yes |
|
|
|
|
#### ApiProviderSchemaType
|
|
|
|
Enum class for api provider schema type.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ApiProviderSchemaType | string | Enum class for api provider schema type. | |
|
|
|
|
#### ApiSchemaParseResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials_schema | [ [ProviderConfig](#providerconfig) ] | | Yes |
|
|
| parameters_schema | [ [ApiToolBundle](#apitoolbundle) ] | | Yes |
|
|
| schema_type | [ApiProviderSchemaType](#apiproviderschematype) | | Yes |
|
|
| warning | object | | Yes |
|
|
|
|
#### ApiToolBundle
|
|
|
|
This class is used to store the schema information of an api based tool.
|
|
such as the url, the method, the parameters, etc.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| author | string | | Yes |
|
|
| icon | string | | No |
|
|
| method | string | | Yes |
|
|
| openapi | object | | Yes |
|
|
| operation_id | string | | No |
|
|
| output_schema | object | | No |
|
|
| parameters | [ [ToolParameter](#toolparameter) ] | | No |
|
|
| server_url | string | | Yes |
|
|
| summary | string | | No |
|
|
|
|
#### ApiToolPreviewResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ApiToolPreviewResponse | | | |
|
|
|
|
#### ApiToolPreviewResult
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| error | string | | No |
|
|
| result | string | | No |
|
|
|
|
#### ApiToolProviderAddPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | object | | Yes |
|
|
| custom_disclaimer | string | | No |
|
|
| icon | [ToolEmojiIcon](#toolemojiicon) | | Yes |
|
|
| labels | [ string ] | | No |
|
|
| privacy_policy | string | | No |
|
|
| provider | string | | Yes |
|
|
| schema | string | | Yes |
|
|
| schema_type | [ApiProviderSchemaType](#apiproviderschematype) | | Yes |
|
|
|
|
#### ApiToolProviderDeletePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| provider | string | | Yes |
|
|
|
|
#### ApiToolProviderUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | object | | Yes |
|
|
| custom_disclaimer | string | | No |
|
|
| icon | [ToolEmojiIcon](#toolemojiicon) | | Yes |
|
|
| labels | [ string ] | | No |
|
|
| original_provider | string | | Yes |
|
|
| privacy_policy | string | | No |
|
|
| provider | string | | Yes |
|
|
| schema | string | | Yes |
|
|
| schema_type | [ApiProviderSchemaType](#apiproviderschematype) | | Yes |
|
|
|
|
#### ApiToolSchemaPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| schema | string | | Yes |
|
|
|
|
#### ApiToolTestPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | object | | Yes |
|
|
| parameters | object | | Yes |
|
|
| provider_name | string | | No |
|
|
| schema | string | | Yes |
|
|
| schema_type | [ApiProviderSchemaType](#apiproviderschematype) | | Yes |
|
|
| tool_name | string | | Yes |
|
|
|
|
#### AppAccessMatrix
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string | | No |
|
|
| items | [ [AccessMatrixItem](#accessmatrixitem) ] | | No |
|
|
|
|
#### AppApiStatusPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enable_api | boolean | Enable or disable API | Yes |
|
|
|
|
#### AppDetail
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_mode | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| description | string | | No |
|
|
| enable_api | boolean | | Yes |
|
|
| enable_site | boolean | | Yes |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| id | string | | Yes |
|
|
| maintainer | string | | No |
|
|
| mode | string | | Yes |
|
|
| model_config | [AppModelConfigResponse](#appmodelconfigresponse) | | No |
|
|
| name | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
| tags | [ [Tag](#tag) ] | | No |
|
|
| tracing | | | No |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
| use_icon_as_answer_icon | boolean | | No |
|
|
| workflow | [WorkflowPartial](#workflowpartial) | | No |
|
|
|
|
#### AppDetailSiteResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_token | string | | No |
|
|
| app_base_url | string | | No |
|
|
| chat_color_theme | string | | No |
|
|
| chat_color_theme_inverted | boolean | | No |
|
|
| code | string | | No |
|
|
| copyright | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| custom_disclaimer | string | | No |
|
|
| customize_domain | string | | No |
|
|
| customize_token_strategy | string | | No |
|
|
| default_language | string | | No |
|
|
| description | string | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string<br>[IconType](#icontype) | | No |
|
|
| icon_url | string | | Yes |
|
|
| input_placeholder | string | | No |
|
|
| privacy_policy | string | | No |
|
|
| prompt_public | boolean | | No |
|
|
| show_workflow_steps | boolean | | No |
|
|
| title | string | | No |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
| use_icon_as_answer_icon | boolean | | No |
|
|
|
|
#### AppDetailWithSite
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_mode | string | | No |
|
|
| api_base_url | string | | No |
|
|
| app_id | string | | No |
|
|
| bound_agent_id | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| deleted_tools | [ [DeletedTool](#deletedtool) ] | | No |
|
|
| description | string | | No |
|
|
| enable_api | boolean | | Yes |
|
|
| enable_site | boolean | | Yes |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| icon_url | string | | Yes |
|
|
| id | string | | Yes |
|
|
| maintainer | string | | No |
|
|
| max_active_requests | integer | | No |
|
|
| mode | string | | Yes |
|
|
| model_config | [AppModelConfigResponse](#appmodelconfigresponse) | | No |
|
|
| name | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
| site | [AppDetailSiteResponse](#appdetailsiteresponse) | | No |
|
|
| tags | [ [Tag](#tag) ] | | No |
|
|
| tracing | | | No |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
| use_icon_as_answer_icon | boolean | | No |
|
|
| workflow | [WorkflowPartial](#workflowpartial) | | No |
|
|
|
|
#### AppDslVersionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_dsl_version | string | | Yes |
|
|
|
|
#### AppExportQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| include_secret | boolean | Include secrets in export | No |
|
|
| workflow_id | string | Specific workflow ID to export | No |
|
|
|
|
#### AppExportResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | string | | Yes |
|
|
|
|
#### AppIconPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| icon | string | Icon data | No |
|
|
| icon_background | string | Icon background color | No |
|
|
| icon_type | [IconType](#icontype) | Icon type | No |
|
|
|
|
#### AppImportPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string | | No |
|
|
| description | string | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| mode | string | Import mode | Yes |
|
|
| name | string | | No |
|
|
| yaml_content | string | | No |
|
|
| yaml_url | string | | No |
|
|
|
|
#### AppImportResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string | | No |
|
|
| app_mode | string | | No |
|
|
| current_dsl_version | string | | Yes |
|
|
| error | string | | No |
|
|
| id | string | | Yes |
|
|
| imported_dsl_version | string | | No |
|
|
| status | [ImportStatus](#importstatus) | | Yes |
|
|
| warnings | [ [DslImportWarning](#dslimportwarning) ] | | No |
|
|
|
|
#### AppListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| creator_ids | [ string ] | Filter by creator account IDs | No |
|
|
| is_created_by_me | boolean | Filter by creator | No |
|
|
| limit | integer, <br>**Default:** 20 | Page size (1-100) | No |
|
|
| mode | string, <br>**Available values:** "advanced-chat", "agent", "agent-chat", "all", "channel", "chat", "completion", "workflow", <br>**Default:** all | App mode filter<br>*Enum:* `"advanced-chat"`, `"agent"`, `"agent-chat"`, `"all"`, `"channel"`, `"chat"`, `"completion"`, `"workflow"` | No |
|
|
| name | string | Filter by app name | No |
|
|
| page | integer, <br>**Default:** 1 | Page number (1-99999) | No |
|
|
| sort_by | string, <br>**Available values:** "earliest_created", "last_modified", "recently_created", <br>**Default:** last_modified | Sort apps by last modified, recently created, or earliest created<br>*Enum:* `"earliest_created"`, `"last_modified"`, `"recently_created"` | No |
|
|
| tag_ids | [ string ] | Filter by tag IDs | No |
|
|
|
|
#### AppMCPServerResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| description | string | | Yes |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| parameters | object<br>[ object ]<br>string | | Yes |
|
|
| server_code | string | | Yes |
|
|
| status | [AppMCPServerStatus](#appmcpserverstatus) | | Yes |
|
|
| updated_at | integer | | No |
|
|
|
|
#### AppMCPServerStatus
|
|
|
|
AppMCPServer Status Enum
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AppMCPServerStatus | string | AppMCPServer Status Enum | |
|
|
|
|
#### AppModelConfigResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_mode | | | No |
|
|
| annotation_reply | | | No |
|
|
| chat_prompt_config | | | No |
|
|
| completion_prompt_config | | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| dataset_configs | | | No |
|
|
| dataset_query_variable | string | | No |
|
|
| external_data_tools | | | No |
|
|
| file_upload | | | No |
|
|
| model | | | No |
|
|
| more_like_this | | | No |
|
|
| opening_statement | string | | No |
|
|
| pre_prompt | string | | No |
|
|
| prompt_type | string | | No |
|
|
| retriever_resource | | | No |
|
|
| sensitive_word_avoidance | | | No |
|
|
| speech_to_text | | | No |
|
|
| suggested_questions | | | No |
|
|
| suggested_questions_after_answer | | | No |
|
|
| text_to_speech | | | No |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
| user_input_form | | | No |
|
|
|
|
#### AppNamePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | Name to check | Yes |
|
|
|
|
#### AppPagination
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AppPartial](#apppartial) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### AppPartial
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_mode | string | | No |
|
|
| app_id | string | | No |
|
|
| author_name | string | | No |
|
|
| bound_agent_id | string | | No |
|
|
| create_user_name | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| description | string | | No |
|
|
| has_draft_trigger | boolean | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| icon_url | string | | Yes |
|
|
| id | string | | Yes |
|
|
| is_starred | boolean | | No |
|
|
| maintainer | string | | No |
|
|
| max_active_requests | integer | | No |
|
|
| mode | string | | Yes |
|
|
| model_config | [ModelConfigPartial](#modelconfigpartial) | | No |
|
|
| name | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
| tags | [ [Tag](#tag) ] | | No |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
| use_icon_as_answer_icon | boolean | | No |
|
|
| workflow | [WorkflowPartial](#workflowpartial) | | No |
|
|
|
|
#### AppSelectorScope
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AppSelectorScope | string | | |
|
|
|
|
#### AppSiteResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string | | Yes |
|
|
| code | string | | No |
|
|
| copyright | string | | No |
|
|
| custom_disclaimer | string | | No |
|
|
| customize_domain | string | | No |
|
|
| customize_token_strategy | string | | Yes |
|
|
| default_language | string | | Yes |
|
|
| description | string | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| input_placeholder | string | | No |
|
|
| privacy_policy | string | | No |
|
|
| prompt_public | boolean | | Yes |
|
|
| show_workflow_steps | boolean | | Yes |
|
|
| title | string | | Yes |
|
|
| use_icon_as_answer_icon | boolean | | Yes |
|
|
|
|
#### AppSiteStatusPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enable_site | boolean | Enable or disable site | Yes |
|
|
|
|
#### AppSiteUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| chat_color_theme | string | | No |
|
|
| chat_color_theme_inverted | boolean | | No |
|
|
| copyright | string | | No |
|
|
| custom_disclaimer | string | | No |
|
|
| customize_domain | string | | No |
|
|
| customize_token_strategy | string | | No |
|
|
| default_language | string | | No |
|
|
| description | string | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| input_placeholder | string | | No |
|
|
| privacy_policy | string | | No |
|
|
| prompt_public | boolean | | No |
|
|
| show_workflow_steps | boolean | | No |
|
|
| title | string | | No |
|
|
| use_icon_as_answer_icon | boolean | | No |
|
|
|
|
#### AppTracePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | Enable or disable tracing | Yes |
|
|
| tracing_provider | string | Tracing provider | No |
|
|
|
|
#### AppTraceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | No |
|
|
| tracing_provider | string | | No |
|
|
|
|
#### AppVariableConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| default | | | No |
|
|
| name | string | | Yes |
|
|
| required | boolean | | No |
|
|
| type | string | | Yes |
|
|
|
|
#### AudioBinaryResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AudioBinaryResponse | string | | |
|
|
|
|
#### AudioTranscriptResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| text | string | | Yes |
|
|
|
|
#### AuthorizedCategory
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| AuthorizedCategory | string | | |
|
|
|
|
#### AutoDisableLogsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| count | integer | | Yes |
|
|
| document_ids | [ string ] | | Yes |
|
|
|
|
#### AvailableModelListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ProviderWithModelsResponse](#providerwithmodelsresponse) ] | | Yes |
|
|
|
|
#### AvatarUrlResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| avatar_url | string | | Yes |
|
|
|
|
#### AverageResponseTimeStatisticItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| latency | number | | Yes |
|
|
|
|
#### AverageResponseTimeStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AverageResponseTimeStatisticItem](#averageresponsetimestatisticitem) ] | | Yes |
|
|
|
|
#### AverageSessionInteractionStatisticItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| interactions | number | | Yes |
|
|
|
|
#### AverageSessionInteractionStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AverageSessionInteractionStatisticItem](#averagesessioninteractionstatisticitem) ] | | Yes |
|
|
|
|
#### BannerListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| BannerListResponse | array | | |
|
|
|
|
#### BannerResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | | | Yes |
|
|
| created_at | string | | No |
|
|
| id | string | | Yes |
|
|
| link | string | | No |
|
|
| sort | integer | | Yes |
|
|
| status | string | | Yes |
|
|
|
|
#### BatchImportPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| upload_file_id | string | | Yes |
|
|
|
|
#### BedrockRetrievalPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| knowledge_id | string | | Yes |
|
|
| query | string | | Yes |
|
|
| retrieval_setting | [BedrockRetrievalSetting](#bedrockretrievalsetting) | | Yes |
|
|
|
|
#### BedrockRetrievalRecordResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | No |
|
|
| metadata | object | | No |
|
|
| score | number | | Yes |
|
|
| title | string | | No |
|
|
|
|
#### BedrockRetrievalResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| records | [ [BedrockRetrievalRecordResponse](#bedrockretrievalrecordresponse) ] | | Yes |
|
|
|
|
#### BedrockRetrievalSetting
|
|
|
|
Retrieval settings for Amazon Bedrock knowledge base queries.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| score_threshold | number | Minimum relevance score threshold | No |
|
|
| top_k | integer | Maximum number of results to retrieve | No |
|
|
|
|
#### BillingInvoiceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| url | string | | Yes |
|
|
|
|
#### BillingModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | Yes |
|
|
| subscription | [SubscriptionModel](#subscriptionmodel) | | Yes |
|
|
|
|
#### BillingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| BillingResponse | object | | |
|
|
|
|
#### BinaryFileResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| BinaryFileResponse | string | | |
|
|
|
|
#### BrandingModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| application_title | string | | Yes |
|
|
| enabled | boolean | | Yes |
|
|
| favicon | string | | Yes |
|
|
| login_page_logo | string | | Yes |
|
|
| workspace_logo | string | | Yes |
|
|
|
|
#### BuiltinCredentialListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| include_credential_ids | [ string ] | Credential IDs to include even if visibility would hide them | No |
|
|
|
|
#### BuiltinProviderDefaultCredentialPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
|
|
#### BuiltinProviderOAuthClientSchemaResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| client_params | object | | No |
|
|
| is_oauth_custom_client_enabled | boolean | | Yes |
|
|
| is_system_oauth_params_exists | boolean | | Yes |
|
|
| redirect_uri | string | | Yes |
|
|
| schema | [ [ProviderConfig](#providerconfig) ] | | Yes |
|
|
|
|
#### BuiltinToolAddPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | object | | Yes |
|
|
| name | string | | No |
|
|
| type | [CredentialType](#credentialtype) | | Yes |
|
|
| visibility | string | | No |
|
|
|
|
#### BuiltinToolCredentialDeletePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | Yes |
|
|
|
|
#### BuiltinToolUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | Yes |
|
|
| credentials | object | | No |
|
|
| name | string | | No |
|
|
|
|
#### ButtonStyle
|
|
|
|
Button styles for user actions.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ButtonStyle | string | Button styles for user actions. | |
|
|
|
|
#### ChangeEmailResetPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| new_email | string | | Yes |
|
|
| token | string | | Yes |
|
|
|
|
#### ChangeEmailSendPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | Yes |
|
|
| language | string | | No |
|
|
| phase | string | | No |
|
|
| token | string | | No |
|
|
|
|
#### ChangeEmailValidityPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | | Yes |
|
|
| email | string | | Yes |
|
|
| token | string | | Yes |
|
|
|
|
#### ChatConversationQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| annotation_status | string, <br>**Available values:** "all", "annotated", "not_annotated", <br>**Default:** all | Annotation status filter<br>*Enum:* `"all"`, `"annotated"`, `"not_annotated"` | No |
|
|
| end | string | End date (YYYY-MM-DD HH:MM) | No |
|
|
| keyword | string | Search keyword | No |
|
|
| limit | integer, <br>**Default:** 20 | Page size (1-100) | No |
|
|
| page | integer, <br>**Default:** 1 | Page number | No |
|
|
| sort_by | string, <br>**Available values:** "-created_at", "-updated_at", "created_at", "updated_at", <br>**Default:** -updated_at | Sort field and direction<br>*Enum:* `"-created_at"`, `"-updated_at"`, `"created_at"`, `"updated_at"` | No |
|
|
| start | string | Start date (YYYY-MM-DD HH:MM) | No |
|
|
|
|
#### ChatMessagePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_id | string | Conversation ID | No |
|
|
| draft_type | string, <br>**Available values:** "debug_build", "draft", <br>**Default:** draft | Agent App debug config source. Use debug_build while the Agent is in build mode.<br>*Enum:* `"debug_build"`, `"draft"` | No |
|
|
| files | [ object ] | Uploaded files | No |
|
|
| inputs | object | | Yes |
|
|
| model_config | object | | No |
|
|
| parent_message_id | string | Parent message ID | No |
|
|
| query | string | User query | Yes |
|
|
| response_mode | string, <br>**Available values:** "blocking", "streaming", <br>**Default:** blocking | Response mode<br>*Enum:* `"blocking"`, `"streaming"` | No |
|
|
| retriever_from | string, <br>**Default:** dev | Retriever source | No |
|
|
|
|
#### ChatMessagesQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_id | string | Conversation ID | Yes |
|
|
| first_id | string | First message ID for pagination | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of messages to return (1-100) | No |
|
|
|
|
#### ChatRequest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_id | string | | No |
|
|
| files | [ object ] | | No |
|
|
| inputs | object | | Yes |
|
|
| parent_message_id | string | | No |
|
|
| query | string | | Yes |
|
|
| retriever_from | string, <br>**Default:** explore_app | | No |
|
|
|
|
#### CheckDependenciesResult
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| leaked_dependencies | [ [PluginDependency](#plugindependency) ] | | No |
|
|
|
|
#### CheckEmailUniquePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | Yes |
|
|
|
|
#### CheckResultView
|
|
|
|
``type_check`` / ``output_check`` per-output summary block.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| passed | boolean | | Yes |
|
|
| reason | string | | No |
|
|
|
|
#### ChildChunkBatchUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| chunks | [ [ChildChunkUpdateArgs](#childchunkupdateargs) ] | | Yes |
|
|
|
|
#### ChildChunkBatchUpdateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ChildChunkResponse](#childchunkresponse) ] | | Yes |
|
|
|
|
#### ChildChunkCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | Child chunk text content. | Yes |
|
|
|
|
#### ChildChunkDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ChildChunkResponse](#childchunkresponse) | | Yes |
|
|
|
|
#### ChildChunkListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword | string | | No |
|
|
| limit | integer, <br>**Default:** 20 | | No |
|
|
| page | integer, <br>**Default:** 1 | | No |
|
|
|
|
#### ChildChunkListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ChildChunkResponse](#childchunkresponse) ] | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
| total_pages | integer | | Yes |
|
|
|
|
#### ChildChunkResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| position | integer | | Yes |
|
|
| segment_id | string | | Yes |
|
|
| type | string | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
| word_count | integer | | Yes |
|
|
|
|
#### ChildChunkUpdateArgs
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | Child chunk text content. | Yes |
|
|
| id | string | Existing child chunk ID. Omit to create a new child chunk. | No |
|
|
|
|
#### ChildChunkUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | Child chunk text content. | Yes |
|
|
|
|
#### CliToolSuggestion
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| command | string | | No |
|
|
| description | string | | No |
|
|
| env_suggestions | [ [EnvSuggestion](#envsuggestion) ] | | No |
|
|
| inferred_from | string | | No |
|
|
| install_commands | [ string ] | | No |
|
|
| name | string | | Yes |
|
|
|
|
#### CodeBasedExtensionQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| module | string | | Yes |
|
|
|
|
#### CodeBasedExtensionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | | Extension data | Yes |
|
|
| module | string | Module name | Yes |
|
|
|
|
#### CompletionConversationQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| annotation_status | string, <br>**Available values:** "all", "annotated", "not_annotated", <br>**Default:** all | Annotation status filter<br>*Enum:* `"all"`, `"annotated"`, `"not_annotated"` | No |
|
|
| end | string | End date (YYYY-MM-DD HH:MM) | No |
|
|
| keyword | string | Search keyword | No |
|
|
| limit | integer, <br>**Default:** 20 | Page size (1-100) | No |
|
|
| page | integer, <br>**Default:** 1 | Page number | No |
|
|
| start | string | Start date (YYYY-MM-DD HH:MM) | No |
|
|
|
|
#### CompletionMessageExplorePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ object ] | | No |
|
|
| inputs | object | | Yes |
|
|
| query | string | | No |
|
|
| response_mode | string | | No |
|
|
| retriever_from | string, <br>**Default:** explore_app | | No |
|
|
|
|
#### CompletionMessagePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ object ] | Uploaded files | No |
|
|
| inputs | object | | Yes |
|
|
| model_config | object | | No |
|
|
| query | string | Query text | No |
|
|
| response_mode | string, <br>**Available values:** "blocking", "streaming", <br>**Default:** blocking | Response mode<br>*Enum:* `"blocking"`, `"streaming"` | No |
|
|
| retriever_from | string, <br>**Default:** dev | Retriever source | No |
|
|
|
|
#### CompletionRequest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ object ] | | No |
|
|
| inputs | object | | Yes |
|
|
| query | string | | No |
|
|
| response_mode | string | | No |
|
|
| retriever_from | string, <br>**Default:** explore_app | | No |
|
|
|
|
#### ComplianceDownloadQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| doc_name | string | Compliance document name | Yes |
|
|
|
|
#### ComplianceDownloadResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ComplianceDownloadResponse | object | | |
|
|
|
|
#### ComposerBindingPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_id | string | | No |
|
|
| binding_type | string, <br>**Available values:** "inline_agent", "roster_agent" | *Enum:* `"inline_agent"`, `"roster_agent"` | Yes |
|
|
| current_snapshot_id | string | | No |
|
|
|
|
#### ComposerCandidateCapabilities
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| human_roster_available | boolean | | No |
|
|
|
|
#### ComposerKnowledgePlaceholderResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| placeholder_name | string | | Yes |
|
|
|
|
#### ComposerSavePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_soul | [AgentSoulConfig](#agentsoulconfig) | | No |
|
|
| binding | [ComposerBindingPayload](#composerbindingpayload) | | No |
|
|
| client_revision_id | string | | No |
|
|
| description | string | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | [AgentIconType](#agenticontype) | | No |
|
|
| idempotency_key | string | | No |
|
|
| new_agent_name | string | | No |
|
|
| node_job | [WorkflowNodeJobConfig](#workflownodejobconfig) | | No |
|
|
| role | string | | No |
|
|
| save_strategy | [ComposerSaveStrategy](#composersavestrategy) | | Yes |
|
|
| soul_lock | [ComposerSoulLockPayload](#composersoullockpayload) | | No |
|
|
| variant | [ComposerVariant](#composervariant) | | Yes |
|
|
| version_note | string | | No |
|
|
|
|
#### ComposerSaveStrategy
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ComposerSaveStrategy | string | | |
|
|
|
|
#### ComposerSoulLockPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| locked | boolean, <br>**Default:** true | | No |
|
|
| unlocked_from_version_id | string | | No |
|
|
|
|
#### ComposerValidationFindingsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| knowledge_retrieval_placeholder | [ [ComposerKnowledgePlaceholderResponse](#composerknowledgeplaceholderresponse) ] | | No |
|
|
| warnings | [ [ComposerValidationWarningResponse](#composervalidationwarningresponse) ] | | No |
|
|
|
|
#### ComposerValidationWarningResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | | Yes |
|
|
| id | string | | No |
|
|
| kind | string | | No |
|
|
| message | string | | No |
|
|
| surface | string | | No |
|
|
|
|
#### ComposerVariant
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ComposerVariant | string | | |
|
|
|
|
#### Condition
|
|
|
|
Condition detail
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| comparison_operator | string, <br>**Available values:** "<", "=", ">", "after", "before", "contains", "empty", "end with", "in", "is", "is not", "not contains", "not empty", "not in", "start with", "≠", "≤", "≥" | Comparison to apply. String operators (`contains`, `not contains`, `start with`, `end with`, `is`, `is not`, `empty`, `not empty`, `in`, `not in`) act on string or array metadata; numeric operators (`=`, `≠`, `>`, `<`, `≥`, `≤`) act on numeric metadata; time operators (`before`, `after`) act on time metadata.<br>*Enum:* `"<"`, `"="`, `">"`, `"after"`, `"before"`, `"contains"`, `"empty"`, `"end with"`, `"in"`, `"is"`, `"is not"`, `"not contains"`, `"not empty"`, `"not in"`, `"start with"`, `"≠"`, `"≤"`, `"≥"` | Yes |
|
|
| name | string | Metadata field name to compare against. | Yes |
|
|
| value | string<br>[ string ]<br>number | Value to compare against. Type depends on `comparison_operator`: string for most string operators, array of strings for `in` and `not in`, number for numeric operators, and omit or use `null` for `empty` and `not empty`. | No |
|
|
|
|
#### ConfigurateMethod
|
|
|
|
Enum class for configurate method of provider model.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ConfigurateMethod | string | Enum class for configurate method of provider model. | |
|
|
|
|
#### ConsoleDatasetListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ids | [ string ] | Filter by dataset IDs | No |
|
|
| include_all | boolean | Include all datasets | No |
|
|
| keyword | string | Search keyword | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of items per page | No |
|
|
| page | integer, <br>**Default:** 1 | Page number | No |
|
|
| tag_ids | [ string ] | Filter by tag IDs | No |
|
|
|
|
#### ConsoleHumanInputFormDefinitionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ConsoleHumanInputFormDefinitionResponse | object | | |
|
|
|
|
#### ConsoleHumanInputFormSubmitResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ConsoleHumanInputFormSubmitResponse | object | | |
|
|
|
|
#### ConsoleSegmentListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [SegmentResponse](#segmentresponse) ] | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
| total_pages | integer | | Yes |
|
|
|
|
#### Conversation
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| admin_feedback_stats | [FeedbackStat](#feedbackstat) | | No |
|
|
| annotation | [ConversationAnnotation](#conversationannotation) | | No |
|
|
| created_at | integer | | No |
|
|
| from_account_id | string | | No |
|
|
| from_account_name | string | | No |
|
|
| from_end_user_id | string | | No |
|
|
| from_end_user_session_id | string | | No |
|
|
| from_source | string | | Yes |
|
|
| id | string | | Yes |
|
|
| message | [SimpleMessageDetail](#simplemessagedetail) | | No |
|
|
| model_config | [SimpleModelConfig](#simplemodelconfig) | | No |
|
|
| read_at | integer | | No |
|
|
| status | string | | Yes |
|
|
| updated_at | integer | | No |
|
|
| user_feedback_stats | [FeedbackStat](#feedbackstat) | | No |
|
|
|
|
#### ConversationAnnotation
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| account | [SimpleAccount](#simpleaccount) | | No |
|
|
| content | string | | Yes |
|
|
| created_at | integer | | No |
|
|
| id | string | | Yes |
|
|
| question | string | | No |
|
|
|
|
#### ConversationAnnotationHitHistory
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| annotation_create_account | [SimpleAccount](#simpleaccount) | | No |
|
|
| annotation_id | string | | Yes |
|
|
| created_at | integer | | No |
|
|
|
|
#### ConversationDetail
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| admin_feedback_stats | [FeedbackStat](#feedbackstat) | | No |
|
|
| annotated | boolean | | Yes |
|
|
| created_at | integer | | No |
|
|
| from_account_id | string | | No |
|
|
| from_end_user_id | string | | No |
|
|
| from_source | string | | Yes |
|
|
| id | string | | Yes |
|
|
| introduction | string | | No |
|
|
| message_count | integer | | Yes |
|
|
| model_config | [ModelConfig](#modelconfig) | | No |
|
|
| status | string | | Yes |
|
|
| updated_at | integer | | No |
|
|
| user_feedback_stats | [FeedbackStat](#feedbackstat) | | No |
|
|
|
|
#### ConversationInfiniteScrollPagination
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [SimpleConversation](#simpleconversation) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
|
|
#### ConversationListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| last_id | string | | No |
|
|
| limit | integer, <br>**Default:** 20 | | No |
|
|
| pinned | boolean | | No |
|
|
|
|
#### ConversationMessageDetail
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| from_account_id | string | | No |
|
|
| from_end_user_id | string | | No |
|
|
| from_source | string | | Yes |
|
|
| id | string | | Yes |
|
|
| message | [MessageDetail](#messagedetail) | | No |
|
|
| model_config | [ModelConfig](#modelconfig) | | No |
|
|
| status | string | | Yes |
|
|
|
|
#### ConversationPagination
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [Conversation](#conversation) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### ConversationRenamePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| auto_generate | boolean | Automatically generate the conversation name. When `true`, the `name` field is ignored. | No |
|
|
| name | string | Conversation name. Required when `auto_generate` is `false`. | No |
|
|
|
|
#### ConversationVariableItemPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| id | string | | No |
|
|
| name | string | | No |
|
|
| value | | | No |
|
|
| value_type | string | | No |
|
|
|
|
#### ConversationVariableResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| description | string | | No |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| updated_at | integer | | No |
|
|
| value | string | | No |
|
|
| value_type | string | | Yes |
|
|
|
|
#### ConversationVariableUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_variables | [ [ConversationVariableItemPayload](#conversationvariableitempayload) ] | Conversation variables for the draft workflow | Yes |
|
|
|
|
#### ConversationVariablesQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_id | string | Conversation ID to filter variables | Yes |
|
|
|
|
#### ConversationWithSummary
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| admin_feedback_stats | [FeedbackStat](#feedbackstat) | | No |
|
|
| annotated | boolean | | Yes |
|
|
| created_at | integer | | No |
|
|
| from_account_id | string | | No |
|
|
| from_account_name | string | | No |
|
|
| from_end_user_id | string | | No |
|
|
| from_end_user_session_id | string | | No |
|
|
| from_source | string | | Yes |
|
|
| id | string | | Yes |
|
|
| message_count | integer | | Yes |
|
|
| model_config | [SimpleModelConfig](#simplemodelconfig) | | No |
|
|
| name | string | | Yes |
|
|
| read_at | integer | | No |
|
|
| status | string | | Yes |
|
|
| status_count | [StatusCount](#statuscount) | | No |
|
|
| summary | string | | Yes |
|
|
| updated_at | integer | | No |
|
|
| user_feedback_stats | [FeedbackStat](#feedbackstat) | | No |
|
|
|
|
#### ConversationWithSummaryPagination
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ConversationWithSummary](#conversationwithsummary) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### ConvertToWorkflowPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| name | string | | No |
|
|
|
|
#### CopyAppPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | Description for the copied app | No |
|
|
| icon | string | Icon | No |
|
|
| icon_background | string | Icon background color | No |
|
|
| icon_type | [IconType](#icontype) | Icon type | No |
|
|
| name | string | Name for the copied app | No |
|
|
|
|
#### CreateAnnotationPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| annotation_reply | object | Annotation reply data | No |
|
|
| answer | string | Answer text | No |
|
|
| content | string | Content text | No |
|
|
| message_id | string | Message ID | No |
|
|
| question | string | Question text | No |
|
|
|
|
#### CreateAppPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | App description (max 400 chars) | No |
|
|
| icon | string | Icon | No |
|
|
| icon_background | string | Icon background color | No |
|
|
| icon_type | [IconType](#icontype) | Icon type | No |
|
|
| mode | string, <br>**Available values:** "advanced-chat", "agent-chat", "chat", "completion", "workflow" | App mode<br>*Enum:* `"advanced-chat"`, `"agent-chat"`, `"chat"`, `"completion"`, `"workflow"` | Yes |
|
|
| name | string | App name | Yes |
|
|
|
|
#### CreateSnippetPayload
|
|
|
|
Payload for creating a new snippet.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| graph | object | | No |
|
|
| icon_info | [IconInfo](#iconinfo) | | No |
|
|
| input_fields | [ [InputFieldDefinition](#inputfielddefinition) ] | | No |
|
|
| name | string | | Yes |
|
|
| type | string, <br>**Available values:** "group", "node", <br>**Default:** node | *Enum:* `"group"`, `"node"` | No |
|
|
|
|
#### CredentialConfiguration
|
|
|
|
Model class for credential configuration.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | Yes |
|
|
| credential_name | string | | Yes |
|
|
|
|
#### CredentialFormSchema
|
|
|
|
Model class for credential form schema.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| default | string | | No |
|
|
| label | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | Yes |
|
|
| max_length | integer | | No |
|
|
| options | [ [FormOption](#formoption) ] | | No |
|
|
| placeholder | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | No |
|
|
| required | boolean, <br>**Default:** true | | No |
|
|
| show_on | [ [FormShowOnObject](#formshowonobject) ], <br>**Default:** | | No |
|
|
| type | [FormType](#formtype) | | Yes |
|
|
| variable | string | | Yes |
|
|
|
|
#### CredentialType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| CredentialType | string | | |
|
|
|
|
#### CustomConfigurationResponse
|
|
|
|
Model class for provider custom configuration response.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| available_credentials | [ [CredentialConfiguration](#credentialconfiguration) ] | | No |
|
|
| can_added_models | [ [UnaddedModelConfiguration](#unaddedmodelconfiguration) ] | | No |
|
|
| current_credential_id | string | | No |
|
|
| current_credential_name | string | | No |
|
|
| custom_models | [ [CustomModelConfiguration](#custommodelconfiguration) ] | | No |
|
|
| status | [CustomConfigurationStatus](#customconfigurationstatus) | | Yes |
|
|
|
|
#### CustomConfigurationStatus
|
|
|
|
Enum class for custom configuration status.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| CustomConfigurationStatus | string | Enum class for custom configuration status. | |
|
|
|
|
#### CustomModelConfiguration
|
|
|
|
Model class for provider custom model configuration.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| available_model_credentials | [ [CredentialConfiguration](#credentialconfiguration) ], <br>**Default:** | | No |
|
|
| credentials | object | | Yes |
|
|
| current_credential_id | string | | No |
|
|
| current_credential_name | string | | No |
|
|
| model | string | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
| unadded_to_model_list | boolean | | No |
|
|
|
|
#### CustomizedPipelineTemplatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| icon_info | object | | No |
|
|
| name | string | | Yes |
|
|
|
|
#### DailyConversationStatisticItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_count | integer | | Yes |
|
|
| date | string | | Yes |
|
|
|
|
#### DailyConversationStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [DailyConversationStatisticItem](#dailyconversationstatisticitem) ] | | Yes |
|
|
|
|
#### DailyMessageStatisticItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| message_count | integer | | Yes |
|
|
|
|
#### DailyMessageStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [DailyMessageStatisticItem](#dailymessagestatisticitem) ] | | Yes |
|
|
|
|
#### DailyTerminalStatisticItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| terminal_count | integer | | Yes |
|
|
|
|
#### DailyTerminalStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [DailyTerminalStatisticItem](#dailyterminalstatisticitem) ] | | Yes |
|
|
|
|
#### DailyTokenCostStatisticItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| currency | string | | No |
|
|
| date | string | | Yes |
|
|
| token_count | integer | | No |
|
|
| total_price | string | | No |
|
|
|
|
#### DailyTokenCostStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [DailyTokenCostStatisticItem](#dailytokencoststatisticitem) ] | | Yes |
|
|
|
|
#### DataSource
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| info_list | [InfoList](#infolist) | | Yes |
|
|
|
|
#### DataSourceIntegrateIconResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| emoji | string | | No |
|
|
| type | string | | No |
|
|
| url | string | | No |
|
|
|
|
#### DataSourceIntegrateListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [DataSourceIntegrateResponse](#datasourceintegrateresponse) ] | | Yes |
|
|
|
|
#### DataSourceIntegratePageResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| page_icon | [DataSourceIntegrateIconResponse](#datasourceintegrateiconresponse) | | Yes |
|
|
| page_id | string | | Yes |
|
|
| page_name | string | | Yes |
|
|
| parent_id | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### DataSourceIntegrateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | Yes |
|
|
| disabled | boolean | | Yes |
|
|
| id | string | | Yes |
|
|
| is_bound | boolean | | Yes |
|
|
| link | string | | Yes |
|
|
| provider | string | | Yes |
|
|
| source_info | [DataSourceIntegrateWorkspaceResponse](#datasourceintegrateworkspaceresponse) | | Yes |
|
|
|
|
#### DataSourceIntegrateWorkspaceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| pages | [ [DataSourceIntegratePageResponse](#datasourceintegratepageresponse) ] | | Yes |
|
|
| total | integer | | Yes |
|
|
| workspace_icon | string | | Yes |
|
|
| workspace_id | string | | Yes |
|
|
| workspace_name | string | | Yes |
|
|
|
|
#### DatasetAccessMatrix
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| dataset_id | string | | No |
|
|
| items | [ [AccessMatrixItem](#accessmatrixitem) ] | | No |
|
|
|
|
#### DatasetAndDocumentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| batch | string | | Yes |
|
|
| dataset | [DatasetResponse](#datasetresponse) | | Yes |
|
|
| documents | [ [DocumentResponse](#documentresponse) ] | | Yes |
|
|
|
|
#### DatasetCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| external_knowledge_api_id | string | | No |
|
|
| external_knowledge_id | string | | No |
|
|
| indexing_technique | string | | No |
|
|
| name | string | | Yes |
|
|
| permission | [PermissionEnum](#permissionenum) | | No |
|
|
| provider | string, <br>**Default:** vendor | | No |
|
|
|
|
#### DatasetDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_count | integer | | Yes |
|
|
| author_name | string | | Yes |
|
|
| built_in_field_enabled | boolean | | Yes |
|
|
| chunk_structure | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| created_by | string | | Yes |
|
|
| data_source_type | string | | Yes |
|
|
| description | string | | Yes |
|
|
| doc_form | string | | Yes |
|
|
| doc_metadata | [ [DatasetDocMetadataResponse](#datasetdocmetadataresponse) ] | | Yes |
|
|
| document_count | integer | | Yes |
|
|
| embedding_available | boolean | | No |
|
|
| embedding_model | string | | Yes |
|
|
| embedding_model_provider | string | | Yes |
|
|
| enable_api | boolean | | Yes |
|
|
| external_knowledge_info | [DatasetExternalKnowledgeInfoResponse](#datasetexternalknowledgeinforesponse) | | No |
|
|
| external_retrieval_model | [DatasetExternalRetrievalModelResponse](#datasetexternalretrievalmodelresponse) | | Yes |
|
|
| icon_info | [DatasetIconInfoResponse](#dataseticoninforesponse) | | No |
|
|
| id | string | | Yes |
|
|
| indexing_technique | string | | Yes |
|
|
| is_multimodal | boolean | | Yes |
|
|
| is_published | boolean | | Yes |
|
|
| maintainer | string | | No |
|
|
| name | string | | Yes |
|
|
| permission | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
| pipeline_id | string | | Yes |
|
|
| provider | string | | Yes |
|
|
| retrieval_model_dict | [DatasetRetrievalModelResponse](#datasetretrievalmodelresponse) | | Yes |
|
|
| runtime_mode | string | | Yes |
|
|
| summary_index_setting | [DatasetSummaryIndexSettingResponse](#datasetsummaryindexsettingresponse) | | No |
|
|
| tags | [ [DatasetTagResponse](#datasettagresponse) ] | | Yes |
|
|
| total_available_documents | integer | | Yes |
|
|
| total_documents | integer | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
| updated_by | string | | Yes |
|
|
| word_count | integer | | Yes |
|
|
|
|
#### DatasetDetailWithPartialMembersResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_count | integer | | Yes |
|
|
| author_name | string | | Yes |
|
|
| built_in_field_enabled | boolean | | Yes |
|
|
| chunk_structure | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| created_by | string | | Yes |
|
|
| data_source_type | string | | Yes |
|
|
| description | string | | Yes |
|
|
| doc_form | string | | Yes |
|
|
| doc_metadata | [ [DatasetDocMetadataResponse](#datasetdocmetadataresponse) ] | | Yes |
|
|
| document_count | integer | | Yes |
|
|
| embedding_available | boolean | | No |
|
|
| embedding_model | string | | Yes |
|
|
| embedding_model_provider | string | | Yes |
|
|
| enable_api | boolean | | Yes |
|
|
| external_knowledge_info | [DatasetExternalKnowledgeInfoResponse](#datasetexternalknowledgeinforesponse) | | No |
|
|
| external_retrieval_model | [DatasetExternalRetrievalModelResponse](#datasetexternalretrievalmodelresponse) | | Yes |
|
|
| icon_info | [DatasetIconInfoResponse](#dataseticoninforesponse) | | No |
|
|
| id | string | | Yes |
|
|
| indexing_technique | string | | Yes |
|
|
| is_multimodal | boolean | | Yes |
|
|
| is_published | boolean | | Yes |
|
|
| maintainer | string | | No |
|
|
| name | string | | Yes |
|
|
| partial_member_list | [ string ] | | No |
|
|
| permission | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
| pipeline_id | string | | Yes |
|
|
| provider | string | | Yes |
|
|
| retrieval_model_dict | [DatasetRetrievalModelResponse](#datasetretrievalmodelresponse) | | Yes |
|
|
| runtime_mode | string | | Yes |
|
|
| summary_index_setting | [DatasetSummaryIndexSettingResponse](#datasetsummaryindexsettingresponse) | | No |
|
|
| tags | [ [DatasetTagResponse](#datasettagresponse) ] | | Yes |
|
|
| total_available_documents | integer | | Yes |
|
|
| total_documents | integer | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
| updated_by | string | | Yes |
|
|
| word_count | integer | | Yes |
|
|
|
|
#### DatasetDocMetadataResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### DatasetExternalKnowledgeInfoResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| external_knowledge_api_endpoint | string | | No |
|
|
| external_knowledge_api_id | string | | No |
|
|
| external_knowledge_api_name | string | | No |
|
|
| external_knowledge_id | string | | No |
|
|
|
|
#### DatasetExternalRetrievalModelResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| score_threshold | number | | No |
|
|
| score_threshold_enabled | boolean | | No |
|
|
| top_k | integer | | Yes |
|
|
|
|
#### DatasetIconInfoResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| icon_url | string | | No |
|
|
|
|
#### DatasetKeywordSettingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword_weight | number | | No |
|
|
|
|
#### DatasetListItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_count | integer | | Yes |
|
|
| author_name | string | | Yes |
|
|
| built_in_field_enabled | boolean | | Yes |
|
|
| chunk_structure | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| created_by | string | | Yes |
|
|
| data_source_type | string | | Yes |
|
|
| description | string | | Yes |
|
|
| doc_form | string | | Yes |
|
|
| doc_metadata | [ [DatasetDocMetadataResponse](#datasetdocmetadataresponse) ] | | Yes |
|
|
| document_count | integer | | Yes |
|
|
| embedding_available | boolean | | No |
|
|
| embedding_model | string | | Yes |
|
|
| embedding_model_provider | string | | Yes |
|
|
| enable_api | boolean | | Yes |
|
|
| external_knowledge_info | [DatasetExternalKnowledgeInfoResponse](#datasetexternalknowledgeinforesponse) | | No |
|
|
| external_retrieval_model | [DatasetExternalRetrievalModelResponse](#datasetexternalretrievalmodelresponse) | | Yes |
|
|
| icon_info | [DatasetIconInfoResponse](#dataseticoninforesponse) | | No |
|
|
| id | string | | Yes |
|
|
| indexing_technique | string | | Yes |
|
|
| is_multimodal | boolean | | Yes |
|
|
| is_published | boolean | | Yes |
|
|
| maintainer | string | | No |
|
|
| name | string | | Yes |
|
|
| partial_member_list | [ string ] | | Yes |
|
|
| permission | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
| pipeline_id | string | | Yes |
|
|
| provider | string | | Yes |
|
|
| retrieval_model_dict | [DatasetRetrievalModelResponse](#datasetretrievalmodelresponse) | | Yes |
|
|
| runtime_mode | string | | Yes |
|
|
| summary_index_setting | [DatasetSummaryIndexSettingResponse](#datasetsummaryindexsettingresponse) | | No |
|
|
| tags | [ [DatasetTagResponse](#datasettagresponse) ] | | Yes |
|
|
| total_available_documents | integer | | Yes |
|
|
| total_documents | integer | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
| updated_by | string | | Yes |
|
|
| word_count | integer | | Yes |
|
|
|
|
#### DatasetListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [DatasetListItemResponse](#datasetlistitemresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### DatasetMetadataBuiltInFieldResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### DatasetMetadataBuiltInFieldsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| fields | [ [DatasetMetadataBuiltInFieldResponse](#datasetmetadatabuiltinfieldresponse) ] | | Yes |
|
|
|
|
#### DatasetMetadataListItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| count | integer | | No |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### DatasetMetadataListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| built_in_field_enabled | boolean | | Yes |
|
|
| doc_metadata | [ [DatasetMetadataListItemResponse](#datasetmetadatalistitemresponse) ] | | Yes |
|
|
|
|
#### DatasetMetadataResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### DatasetQueryContentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | Yes |
|
|
| content_type | string | | Yes |
|
|
| file_info | [DatasetQueryFileInfoResponse](#datasetqueryfileinforesponse) | | No |
|
|
|
|
#### DatasetQueryDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | Yes |
|
|
| created_by | string | | Yes |
|
|
| created_by_role | string | | Yes |
|
|
| id | string | | Yes |
|
|
| queries | [ [DatasetQueryContentResponse](#datasetquerycontentresponse) ] | | Yes |
|
|
| source | string | | Yes |
|
|
| source_app_id | string | | Yes |
|
|
|
|
#### DatasetQueryFileInfoResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| extension | string | | Yes |
|
|
| id | string | | Yes |
|
|
| mime_type | string | | Yes |
|
|
| name | string | | Yes |
|
|
| size | integer | | Yes |
|
|
| source_url | string | | Yes |
|
|
|
|
#### DatasetQueryListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [DatasetQueryDetailResponse](#datasetquerydetailresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### DatasetRerankingModelResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| reranking_model_name | string | | No |
|
|
| reranking_provider_name | string | | No |
|
|
|
|
#### DatasetResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| data_source_type | string | | No |
|
|
| description | string | | No |
|
|
| id | string | | Yes |
|
|
| indexing_technique | string | | No |
|
|
| name | string | | Yes |
|
|
| permission | string | | No |
|
|
|
|
#### DatasetRetrievalModelResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| reranking_enable | boolean | | Yes |
|
|
| reranking_mode | string | | No |
|
|
| reranking_model | [DatasetRerankingModelResponse](#datasetrerankingmodelresponse) | | No |
|
|
| score_threshold | number | | No |
|
|
| score_threshold_enabled | boolean | | Yes |
|
|
| search_method | string | | Yes |
|
|
| top_k | integer | | Yes |
|
|
| weights | [DatasetWeightedScoreResponse](#datasetweightedscoreresponse) | | No |
|
|
|
|
#### DatasetSummaryIndexSettingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enable | boolean | | No |
|
|
| model_name | string | | No |
|
|
| model_provider_name | string | | No |
|
|
| summary_prompt | string | | No |
|
|
|
|
#### DatasetTagResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### DatasetUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| embedding_model | string | | No |
|
|
| embedding_model_provider | string | | No |
|
|
| external_knowledge_api_id | string | | No |
|
|
| external_knowledge_id | string | | No |
|
|
| external_retrieval_model | object | | No |
|
|
| icon_info | object | | No |
|
|
| indexing_technique | string | | No |
|
|
| is_multimodal | boolean | | No |
|
|
| name | string | | No |
|
|
| partial_member_list | [ object ] | | No |
|
|
| permission | [PermissionEnum](#permissionenum) | | No |
|
|
| retrieval_model | object | | No |
|
|
| summary_index_setting | object | | No |
|
|
|
|
#### DatasetVectorSettingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| embedding_model_name | string | | No |
|
|
| embedding_provider_name | string | | No |
|
|
| vector_weight | number | | No |
|
|
|
|
#### DatasetWeightedScoreResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword_setting | [DatasetKeywordSettingResponse](#datasetkeywordsettingresponse) | | No |
|
|
| vector_setting | [DatasetVectorSettingResponse](#datasetvectorsettingresponse) | | No |
|
|
| weight_type | string | | No |
|
|
|
|
#### DatasourceCredentialDeletePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | Yes |
|
|
|
|
#### DatasourceCredentialListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | [ [DatasourceCredentialResponse](#datasourcecredentialresponse) ] | | Yes |
|
|
|
|
#### DatasourceCredentialPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | object | Plugin-defined credential parameters. The schema is declared by the datasource provider. | Yes |
|
|
| name | string | | No |
|
|
|
|
#### DatasourceCredentialResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| avatar_url | string | | Yes |
|
|
| credential | object | Obfuscated plugin-defined credential parameters from the datasource provider. | Yes |
|
|
| id | string | | Yes |
|
|
| is_default | boolean | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### DatasourceCredentialUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | Yes |
|
|
| credentials | object | Plugin-defined credential parameters. The schema is declared by the datasource provider. | No |
|
|
| name | string | | No |
|
|
|
|
#### DatasourceCustomClientPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| client_params | object | Plugin-defined OAuth client parameters. The schema is declared by the datasource provider. | No |
|
|
| enable_oauth_custom_client | boolean | | No |
|
|
|
|
#### DatasourceDefaultPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
|
|
#### DatasourceNodeRunPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | No |
|
|
| datasource_type | string | | Yes |
|
|
| inputs | object | | Yes |
|
|
|
|
#### DatasourceOAuthAuthorizationQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | Credential ID to reauthorize | No |
|
|
|
|
#### DatasourceOAuthCallbackQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | Authorization code from OAuth provider | No |
|
|
| context_id | string | OAuth proxy context ID | No |
|
|
| error | string | Error message from OAuth provider | No |
|
|
| state | string | OAuth state parameter | No |
|
|
|
|
#### DatasourceOAuthSchemaResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| client_schema | [ [ProviderConfig](#providerconfig) ] | | Yes |
|
|
| credentials_schema | [ [ProviderConfig](#providerconfig) ] | | Yes |
|
|
| is_oauth_custom_client_enabled | boolean | | Yes |
|
|
| is_system_oauth_params_exists | boolean | | Yes |
|
|
| oauth_custom_client_params | object | Masked plugin-defined OAuth client parameters, when configured for the tenant. | Yes |
|
|
| redirect_uri | string | | Yes |
|
|
|
|
#### DatasourceProviderAuthListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | [ [DatasourceProviderAuthResponse](#datasourceproviderauthresponse) ] | | Yes |
|
|
|
|
#### DatasourceProviderAuthResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| author | string | | Yes |
|
|
| credential_schema | [ [ProviderConfig](#providerconfig) ] | | Yes |
|
|
| credentials_list | [ [DatasourceCredentialResponse](#datasourcecredentialresponse) ] | | Yes |
|
|
| description | [I18nObject](#i18nobject) | | Yes |
|
|
| icon | string | | Yes |
|
|
| label | [I18nObject](#i18nobject) | | Yes |
|
|
| name | string | | Yes |
|
|
| oauth_schema | [DatasourceOAuthSchemaResponse](#datasourceoauthschemaresponse) | | Yes |
|
|
| plugin_id | string | | Yes |
|
|
| plugin_unique_identifier | string | | Yes |
|
|
| provider | string | | Yes |
|
|
|
|
#### DatasourceProviderEntity
|
|
|
|
Datasource provider entity
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials_schema | [ [ProviderConfig](#providerconfig) ] | | No |
|
|
| identity | [DatasourceProviderIdentity](#datasourceprovideridentity) | | Yes |
|
|
| oauth_schema | [OAuthSchema](#oauthschema) | | No |
|
|
| provider_type | [DatasourceProviderType](#datasourceprovidertype) | | Yes |
|
|
|
|
#### DatasourceProviderIdentity
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| author | string | The author of the tool | Yes |
|
|
| description | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | The description of the tool | Yes |
|
|
| icon | string | The icon of the tool | Yes |
|
|
| label | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | The label of the tool | Yes |
|
|
| name | string | The name of the tool | Yes |
|
|
| tags | [ [ToolLabelEnum](#toollabelenum) ] | The tags of the tool | No |
|
|
|
|
#### DatasourceProviderType
|
|
|
|
Enum class for datasource provider
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| DatasourceProviderType | string | Enum class for datasource provider | |
|
|
|
|
#### DatasourceUpdateNamePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### DatasourceVariablesPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| datasource_info | object | | Yes |
|
|
| datasource_type | string | | Yes |
|
|
| start_node_id | string | | Yes |
|
|
| start_node_title | string | | Yes |
|
|
|
|
#### DeclaredArrayItem
|
|
|
|
Per-item shape for an ``array``-typed declared output.
|
|
|
|
PRD §OUTPUT 配置框 keeps arrays one level deep on first version; nested arrays
|
|
are rejected so the runtime type checker and JSON Schema stay easy to reason
|
|
about. Stage 4 §4.2.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| children | [ { **"array_item"**: , **"children"**: [ object ], **"description"**: , **"file"**: , **"name"**: string, **"required"**: boolean, **"type"**: string, <br>**Available values:** "array", "boolean", "file", "number", "object", "string" } ] | | No |
|
|
| description | string | | No |
|
|
| type | [DeclaredOutputType](#declaredoutputtype) | | Yes |
|
|
|
|
#### DeclaredOutputCheckConfig
|
|
|
|
File-output content check via a model-based comparison against a benchmark file.
|
|
|
|
Per PRD §OUTPUT 配置框, output check is **file-only** and optional. Stage 4 §4.3.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| benchmark_file_ref | [AgentFileRefConfig](#agentfilerefconfig) | | No |
|
|
| enabled | boolean | | No |
|
|
| model_ref | [AgentSoulModelConfig](#agentsoulmodelconfig) | | No |
|
|
| prompt | string | | No |
|
|
|
|
#### DeclaredOutputConfig
|
|
|
|
One declared output of a Workflow Agent Node.
|
|
|
|
Stage 4 normalizes the shape: ``check`` is singular (was ``checks: list`` in
|
|
stage 3), and ``failure_strategy`` defaults to a populated value so runtime
|
|
code can call ``output.failure_strategy.on_failure`` without None-guards.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| array_item | [DeclaredArrayItem](#declaredarrayitem) | | No |
|
|
| check | [DeclaredOutputCheckConfig](#declaredoutputcheckconfig) | | No |
|
|
| children | [ { **"array_item"**: , **"children"**: [ object ], **"description"**: , **"file"**: , **"name"**: string, **"required"**: boolean, **"type"**: string, <br>**Available values:** "array", "boolean", "file", "number", "object", "string" } ] | | No |
|
|
| description | string | | No |
|
|
| failure_strategy | [DeclaredOutputFailureStrategy](#declaredoutputfailurestrategy) | | No |
|
|
| file | [DeclaredOutputFileConfig](#declaredoutputfileconfig) | | No |
|
|
| id | string | | No |
|
|
| name | string | | Yes |
|
|
| required | boolean, <br>**Default:** true | | No |
|
|
| type | [DeclaredOutputType](#declaredoutputtype) | | Yes |
|
|
|
|
#### DeclaredOutputFailureStrategy
|
|
|
|
Per-output failure handling.
|
|
|
|
A single strategy applies to both ``type_check`` and ``output_check`` failures
|
|
(PRD does not distinguish them at the UX level). Stage 4 §4.4.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| default_value | | | No |
|
|
| on_failure | [OutputErrorStrategy](#outputerrorstrategy) | | No |
|
|
| retry | [DeclaredOutputRetryConfig](#declaredoutputretryconfig) | | No |
|
|
|
|
#### DeclaredOutputFileConfig
|
|
|
|
File-type output metadata. Both lists empty means "any file accepted".
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| extensions | [ string ] | | No |
|
|
| mime_types | [ string ] | | No |
|
|
|
|
#### DeclaredOutputRetryConfig
|
|
|
|
Per-output retry configuration that mirrors ``graphon.RetryConfig`` shape.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | No |
|
|
| max_retries | integer | | No |
|
|
| retry_interval_ms | integer | | No |
|
|
|
|
#### DeclaredOutputType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| DeclaredOutputType | string | | |
|
|
|
|
#### DefaultBlockConfigQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| q | string | | No |
|
|
|
|
#### DefaultBlockConfigResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| DefaultBlockConfigResponse | object | | |
|
|
|
|
#### DefaultBlockConfigsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| DefaultBlockConfigsResponse | array | | |
|
|
|
|
#### DefaultModelDataResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [DefaultModelResponse](#defaultmodelresponse) | | No |
|
|
|
|
#### DefaultModelResponse
|
|
|
|
Default model entity.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| model | string | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
| provider | [SimpleProviderEntityResponse](#simpleproviderentityresponse) | | Yes |
|
|
|
|
#### DeletedTool
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| provider_id | string | | Yes |
|
|
| tool_name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### DeploymentEdition
|
|
|
|
Enum representing the deployment edition of the platform.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| DeploymentEdition | string | Enum representing the deployment edition of the platform. | |
|
|
|
|
#### DismissNotificationPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| notification_id | string | | Yes |
|
|
|
|
#### DocumentBatchDownloadZipPayload
|
|
|
|
Request payload for bulk downloading documents as a zip archive.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| document_ids | [ string (uuid) ] | List of document IDs to include in the ZIP download. | Yes |
|
|
|
|
#### DocumentDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| archived | boolean | | No |
|
|
| average_segment_length | number | | No |
|
|
| completed_at | integer | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| created_from | string | | No |
|
|
| data_source_detail_dict | | | No |
|
|
| data_source_info | | | No |
|
|
| data_source_type | string | | No |
|
|
| dataset_process_rule | | | No |
|
|
| dataset_process_rule_id | string | | No |
|
|
| disabled_at | integer | | No |
|
|
| disabled_by | string | | No |
|
|
| display_status | string | | No |
|
|
| doc_form | string | | No |
|
|
| doc_language | string | | No |
|
|
| doc_metadata | [ [DocumentMetadataResponse](#documentmetadataresponse) ] | | No |
|
|
| doc_type | string | | No |
|
|
| document_process_rule | | | No |
|
|
| enabled | boolean | | No |
|
|
| error | string | | No |
|
|
| hit_count | integer | | No |
|
|
| id | string | | Yes |
|
|
| indexing_latency | number | | No |
|
|
| indexing_status | string | | No |
|
|
| name | string | | No |
|
|
| need_summary | boolean | | No |
|
|
| position | integer | | No |
|
|
| segment_count | integer | | No |
|
|
| tokens | integer | | No |
|
|
| updated_at | integer | | No |
|
|
|
|
#### DocumentMetadataOperation
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| document_id | string | Document ID whose metadata should be updated. | Yes |
|
|
| metadata_list | [ [MetadataDetail](#metadatadetail) ] | Metadata fields to update. | Yes |
|
|
| partial_update | boolean | Whether to partially update metadata, keeping existing values for unspecified fields. | No |
|
|
|
|
#### DocumentMetadataResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
| value | string<br>integer<br>number<br>boolean | | No |
|
|
|
|
#### DocumentMetadataUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| doc_metadata | | | No |
|
|
| doc_type | string | | No |
|
|
|
|
#### DocumentPipelineExecutionLogResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| datasource_info | [JsonValue](#jsonvalue) | | No |
|
|
| datasource_node_id | string | | No |
|
|
| datasource_type | string | | No |
|
|
| input_data | [JsonValue](#jsonvalue) | | No |
|
|
|
|
#### DocumentRenamePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | | Yes |
|
|
|
|
#### DocumentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| archived | boolean | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| created_from | string | | No |
|
|
| data_source_detail_dict | | | No |
|
|
| data_source_info | | | No |
|
|
| data_source_type | string | | No |
|
|
| dataset_process_rule_id | string | | No |
|
|
| disabled_at | integer | | No |
|
|
| disabled_by | string | | No |
|
|
| display_status | string | | No |
|
|
| doc_form | string | | No |
|
|
| doc_metadata | [ [DocumentMetadataResponse](#documentmetadataresponse) ] | | No |
|
|
| enabled | boolean | | No |
|
|
| error | string | | No |
|
|
| hit_count | integer | | No |
|
|
| id | string | | Yes |
|
|
| indexing_status | string | | No |
|
|
| name | string | | Yes |
|
|
| need_summary | boolean | | No |
|
|
| position | integer | | No |
|
|
| summary_index_status | string | | No |
|
|
| tokens | integer | | No |
|
|
| word_count | integer | | No |
|
|
|
|
#### DocumentRetryPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| document_ids | [ string ] | | Yes |
|
|
|
|
#### DocumentStatusListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [DocumentStatusResponse](#documentstatusresponse) ] | | Yes |
|
|
|
|
#### DocumentStatusResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cleaning_completed_at | integer | | Yes |
|
|
| completed_at | integer | | Yes |
|
|
| completed_segments | integer | | No |
|
|
| error | string | | Yes |
|
|
| id | string | | Yes |
|
|
| indexing_status | string | | Yes |
|
|
| parsing_completed_at | integer | | Yes |
|
|
| paused_at | integer | | Yes |
|
|
| processing_started_at | integer | | Yes |
|
|
| splitting_completed_at | integer | | Yes |
|
|
| stopped_at | integer | | Yes |
|
|
| total_segments | integer | | No |
|
|
|
|
#### DocumentSummaryStatusResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| summaries | [ [SummaryEntryResponse](#summaryentryresponse) ] | | Yes |
|
|
| summary_status | [SummaryStatusResponse](#summarystatusresponse) | | Yes |
|
|
| total_segments | integer | | Yes |
|
|
|
|
#### DocumentWithSegmentsListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [DocumentWithSegmentsResponse](#documentwithsegmentsresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### DocumentWithSegmentsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| archived | boolean | | No |
|
|
| completed_segments | integer | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| created_from | string | | No |
|
|
| data_source_detail_dict | | | No |
|
|
| data_source_info | | | No |
|
|
| data_source_type | string | | No |
|
|
| dataset_process_rule_id | string | | No |
|
|
| disabled_at | integer | | No |
|
|
| disabled_by | string | | No |
|
|
| display_status | string | | No |
|
|
| doc_form | string | | No |
|
|
| doc_metadata | [ [DocumentMetadataResponse](#documentmetadataresponse) ] | | No |
|
|
| enabled | boolean | | No |
|
|
| error | string | | No |
|
|
| hit_count | integer | | No |
|
|
| id | string | | Yes |
|
|
| indexing_status | string | | No |
|
|
| name | string | | Yes |
|
|
| need_summary | boolean | | No |
|
|
| position | integer | | No |
|
|
| process_rule_dict | | | No |
|
|
| summary_index_status | string | | No |
|
|
| tokens | integer | | No |
|
|
| total_segments | integer | | No |
|
|
| word_count | integer | | No |
|
|
|
|
#### DraftWorkflowNodeRunPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ object ] | | No |
|
|
| inputs | object | | Yes |
|
|
| query | string | | No |
|
|
|
|
#### DraftWorkflowRunPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| datasource_info_list | [ object ] | | Yes |
|
|
| datasource_type | string | | Yes |
|
|
| inputs | object | | Yes |
|
|
| start_node_id | string | | Yes |
|
|
|
|
#### DraftWorkflowSyncPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_variables | [ object ] | | No |
|
|
| environment_variables | [ object ] | | No |
|
|
| features | object | | No |
|
|
| graph | object | | Yes |
|
|
| hash | string | | No |
|
|
| rag_pipeline_variables | [ object ] | | No |
|
|
|
|
#### DraftWorkflowTriggerRunAllPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| node_ids | [ string ] | | Yes |
|
|
|
|
#### DraftWorkflowTriggerRunPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| node_id | string | | Yes |
|
|
|
|
#### DraftWorkflowTriggerRunRequest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| node_id | string | Node ID | Yes |
|
|
|
|
#### DslImportWarning
|
|
|
|
Portable DSL reference that could not be restored in the target workspace.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | | Yes |
|
|
| details | object | | No |
|
|
| message | string | | Yes |
|
|
| path | string | | Yes |
|
|
|
|
#### EducationActivatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| institution | string | | Yes |
|
|
| role | string | | Yes |
|
|
| token | string | | Yes |
|
|
|
|
#### EducationAutocompleteQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keywords | string | | Yes |
|
|
| limit | integer, <br>**Default:** 20 | | No |
|
|
| page | integer | | No |
|
|
|
|
#### EducationAutocompleteResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| curr_page | integer | | No |
|
|
| data | [ string ] | | No |
|
|
| has_next | boolean | | No |
|
|
|
|
#### EducationModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| activated | boolean | | Yes |
|
|
| enabled | boolean | | Yes |
|
|
|
|
#### EducationStatusResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allow_refresh | boolean | | No |
|
|
| expire_at | integer | | No |
|
|
| is_student | boolean | | No |
|
|
| result | boolean | | No |
|
|
|
|
#### EducationVerifyResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| token | string | | No |
|
|
|
|
#### EmailCodeLoginPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | | Yes |
|
|
| email | string | | Yes |
|
|
| language | string | | No |
|
|
| timezone | string | | No |
|
|
| token | string | | Yes |
|
|
|
|
#### EmailPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | Yes |
|
|
| language | string | | No |
|
|
|
|
#### EmailRegisterResetPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| language | string | | No |
|
|
| new_password | string | | Yes |
|
|
| password_confirm | string | | Yes |
|
|
| timezone | string | | No |
|
|
| token | string | | Yes |
|
|
|
|
#### EmailRegisterResetResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [EmailRegisterTokenPairResponse](#emailregistertokenpairresponse) | | Yes |
|
|
| result | string | | Yes |
|
|
|
|
#### EmailRegisterSendPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | Email address | Yes |
|
|
| language | string | Language code | No |
|
|
|
|
#### EmailRegisterTokenPairResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_token | string | | Yes |
|
|
| csrf_token | string | | Yes |
|
|
| refresh_token | string | | Yes |
|
|
|
|
#### EmailRegisterValidityPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | | Yes |
|
|
| email | string | | Yes |
|
|
| token | string | | Yes |
|
|
|
|
#### EmptyObjectResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| EmptyObjectResponse | object | | |
|
|
|
|
#### Endpoint
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | No |
|
|
|
|
#### EndpointCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | | Yes |
|
|
| plugin_unique_identifier | string | | Yes |
|
|
| settings | object | | Yes |
|
|
|
|
#### EndpointDeclaration
|
|
|
|
declaration of an endpoint
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| hidden | boolean | | No |
|
|
| method | string | | Yes |
|
|
| path | string | | Yes |
|
|
|
|
#### EndpointDeclarationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| hidden | boolean | | No |
|
|
| method | string | | Yes |
|
|
| path | string | | Yes |
|
|
|
|
#### EndpointIdPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| endpoint_id | string | | Yes |
|
|
|
|
#### EndpointListForPluginQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| page | integer | | Yes |
|
|
| page_size | integer | | Yes |
|
|
| plugin_id | string | | Yes |
|
|
|
|
#### EndpointListItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | dateTime | | Yes |
|
|
| declaration | [EndpointProviderDeclarationResponse](#endpointproviderdeclarationresponse) | | No |
|
|
| enabled | boolean | | Yes |
|
|
| expired_at | dateTime | | Yes |
|
|
| hook_id | string | | Yes |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| plugin_id | string | | Yes |
|
|
| settings | object | | Yes |
|
|
| tenant_id | string | | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
| url | string | | Yes |
|
|
|
|
#### EndpointListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| page | integer | | Yes |
|
|
| page_size | integer | | Yes |
|
|
|
|
#### EndpointListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| endpoints | [ [EndpointListItemResponse](#endpointlistitemresponse) ] | Endpoint information | Yes |
|
|
|
|
#### EndpointProviderConfigI18nResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| en_US | string | | Yes |
|
|
| ja_JP | string | | No |
|
|
| pt_BR | string | | No |
|
|
| zh_Hans | string | | No |
|
|
|
|
#### EndpointProviderConfigOptionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| label | [EndpointProviderConfigI18nResponse](#endpointproviderconfigi18nresponse) | | Yes |
|
|
| value | string | | Yes |
|
|
|
|
#### EndpointProviderConfigResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| default | integer<br>string<br>number<br>boolean | | No |
|
|
| help | [EndpointProviderConfigI18nResponse](#endpointproviderconfigi18nresponse) | | No |
|
|
| label | [EndpointProviderConfigI18nResponse](#endpointproviderconfigi18nresponse) | | No |
|
|
| multiple | boolean | | No |
|
|
| name | string | | Yes |
|
|
| options | [ [EndpointProviderConfigOptionResponse](#endpointproviderconfigoptionresponse) ] | | No |
|
|
| placeholder | [EndpointProviderConfigI18nResponse](#endpointproviderconfigi18nresponse) | | No |
|
|
| required | boolean | | No |
|
|
| scope | [EndpointProviderConfigScope](#endpointproviderconfigscope) | | No |
|
|
| type | [ProviderConfigType](#providerconfigtype) | | Yes |
|
|
| url | string | | No |
|
|
|
|
#### EndpointProviderConfigScope
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| EndpointProviderConfigScope | string | | |
|
|
|
|
#### EndpointProviderDeclaration
|
|
|
|
declaration of an endpoint group
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| endpoints | [ [EndpointDeclaration](#endpointdeclaration) ] | | No |
|
|
| settings | [ [ProviderConfig](#providerconfig) ] | | No |
|
|
|
|
#### EndpointProviderDeclarationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| endpoints | [ [EndpointDeclarationResponse](#endpointdeclarationresponse) ] | | No |
|
|
| settings | [ [EndpointProviderConfigResponse](#endpointproviderconfigresponse) ] | | No |
|
|
|
|
#### EndpointSettingsPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | | Yes |
|
|
| settings | object | | Yes |
|
|
|
|
#### EndpointUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | | Yes |
|
|
| settings | object | | Yes |
|
|
|
|
#### EnvSuggestion
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| key | string | | Yes |
|
|
| reason | string | | No |
|
|
| secret_likely | boolean | | No |
|
|
|
|
#### EnvironmentVariableItemPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| id | string | | No |
|
|
| name | string | | No |
|
|
| value | | | No |
|
|
| value_type | string | | No |
|
|
|
|
#### EnvironmentVariableItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| editable | boolean | | Yes |
|
|
| edited | boolean | | Yes |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| selector | [ string ] | | Yes |
|
|
| type | string | | Yes |
|
|
| value | | | Yes |
|
|
| value_type | string | | Yes |
|
|
| visible | boolean | | Yes |
|
|
|
|
#### EnvironmentVariableListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [EnvironmentVariableItemResponse](#environmentvariableitemresponse) ] | | Yes |
|
|
|
|
#### EnvironmentVariableUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| environment_variables | [ [EnvironmentVariableItemPayload](#environmentvariableitempayload) ] | Environment variables for the draft workflow | Yes |
|
|
|
|
#### ErrorDocsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [DocumentStatusResponse](#documentstatusresponse) ] | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### EventApiEntity
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | [I18nObject](#i18nobject) | The description of the trigger | Yes |
|
|
| identity | [EventIdentity](#eventidentity) | The identity of the trigger | Yes |
|
|
| name | string | The name of the trigger | Yes |
|
|
| output_schema | object | The output schema of the trigger | Yes |
|
|
| parameters | [ [EventParameter](#eventparameter) ] | The parameters of the trigger | Yes |
|
|
|
|
#### EventEntity
|
|
|
|
The configuration of an event
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | The description of the event | Yes |
|
|
| identity | [EventIdentity](#eventidentity) | | Yes |
|
|
| output_schema | object | The output schema that this event produces | No |
|
|
| parameters | [ [EventParameter](#eventparameter) ] | The parameters of the event | No |
|
|
|
|
#### EventIdentity
|
|
|
|
The identity of the event
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| author | string | The author of the event | Yes |
|
|
| label | [I18nObject](#i18nobject) | The label of the event | Yes |
|
|
| name | string | The name of the event | Yes |
|
|
| provider | string | The provider of the event | No |
|
|
|
|
#### EventParameter
|
|
|
|
The parameter of the event
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| auto_generate | [PluginParameterAutoGenerate](#pluginparameterautogenerate) | The auto generate of the parameter | No |
|
|
| default | integer<br>number<br>string<br>[ object ] | | No |
|
|
| description | [I18nObject](#i18nobject) | | No |
|
|
| label | [I18nObject](#i18nobject) | The label presented to the user | Yes |
|
|
| max | number<br>integer | | No |
|
|
| min | number<br>integer | | No |
|
|
| multiple | boolean | Whether the parameter is multiple select, only valid for select or dynamic-select type | No |
|
|
| name | string | The name of the parameter | Yes |
|
|
| options | [ [PluginParameterOption](#pluginparameteroption) ] | | No |
|
|
| precision | integer | | No |
|
|
| required | boolean | | No |
|
|
| scope | string | | No |
|
|
| template | [PluginParameterTemplate](#pluginparametertemplate) | The template of the parameter | No |
|
|
| type | [EventParameterType](#eventparametertype) | | Yes |
|
|
|
|
#### EventParameterType
|
|
|
|
The type of the parameter
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| EventParameterType | string | The type of the parameter | |
|
|
|
|
#### EventStreamResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| EventStreamResponse | string | | |
|
|
|
|
#### ExecutionContentType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ExecutionContentType | string | | |
|
|
|
|
#### ExploreAppMetaResponse
|
|
|
|
Metadata consumed by the installed-app chat UI.
|
|
|
|
Built-in tool icons are URL strings; API-based tool icons are provider-defined payload objects.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| tool_icons | object | | No |
|
|
|
|
#### ExploreMessageInfiniteScrollPagination
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ExploreMessageListItem](#exploremessagelistitem) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
|
|
#### ExploreMessageListItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_thoughts | [ [AgentThought](#agentthought) ] | | Yes |
|
|
| answer | string | | Yes |
|
|
| answer_tokens | integer | | No |
|
|
| conversation_id | string | | Yes |
|
|
| created_at | integer | | No |
|
|
| currency | string | | No |
|
|
| error | string | | No |
|
|
| extra_contents | [ [HumanInputContent](#humaninputcontent) ] | | Yes |
|
|
| feedback | [SimpleFeedback](#simplefeedback) | | No |
|
|
| id | string | | Yes |
|
|
| inputs | object | | Yes |
|
|
| message_files | [ [MessageFile](#messagefile) ] | | Yes |
|
|
| message_tokens | integer | | No |
|
|
| metadata | [JSONValueType](#jsonvaluetype) | | No |
|
|
| parent_message_id | string | | No |
|
|
| provider_response_latency | number | | No |
|
|
| query | string | | Yes |
|
|
| retriever_resources | [ [RetrieverResource](#retrieverresource) ] | | Yes |
|
|
| status | string | | Yes |
|
|
| total_price | string | | No |
|
|
| total_tokens | integer | | Yes |
|
|
|
|
#### ExternalApiTemplateListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword | string | Search keyword | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of items per page | No |
|
|
| page | integer, <br>**Default:** 1 | Page number | No |
|
|
|
|
#### ExternalDatasetCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| external_knowledge_api_id | string | | Yes |
|
|
| external_knowledge_id | string | | Yes |
|
|
| external_retrieval_model | object | | No |
|
|
| name | string | | Yes |
|
|
|
|
#### ExternalHitTestingPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| external_retrieval_model | object | | No |
|
|
| metadata_filtering_conditions | object | | No |
|
|
| query | string | | Yes |
|
|
|
|
#### ExternalHitTestingQueryResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | Yes |
|
|
|
|
#### ExternalHitTestingRecordResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | No |
|
|
| metadata | object | | No |
|
|
| score | number | | No |
|
|
| title | string | | No |
|
|
|
|
#### ExternalHitTestingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| query | [ExternalHitTestingQueryResponse](#externalhittestingqueryresponse) | | Yes |
|
|
| records | [ [ExternalHitTestingRecordResponse](#externalhittestingrecordresponse) ] | | Yes |
|
|
|
|
#### ExternalKnowledgeApiBindingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### ExternalKnowledgeApiListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ExternalKnowledgeApiResponse](#externalknowledgeapiresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### ExternalKnowledgeApiPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | | Yes |
|
|
| settings | object | | Yes |
|
|
|
|
#### ExternalKnowledgeApiResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | string | | Yes |
|
|
| created_by | string | | Yes |
|
|
| dataset_bindings | [ [ExternalKnowledgeApiBindingResponse](#externalknowledgeapibindingresponse) ] | | Yes |
|
|
| description | string | | Yes |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| settings | object | | Yes |
|
|
| tenant_id | string | | Yes |
|
|
|
|
#### FeatureModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| annotation_quota_limit | [LimitationModel](#limitationmodel) | | Yes |
|
|
| api_rate_limit | [Quota](#quota) | | Yes |
|
|
| apps | [LimitationModel](#limitationmodel) | | Yes |
|
|
| billing | [BillingModel](#billingmodel) | | Yes |
|
|
| can_replace_logo | boolean | | Yes |
|
|
| dataset_operator_enabled | boolean | | Yes |
|
|
| docs_processing | string, <br>**Default:** standard | | Yes |
|
|
| documents_upload_quota | [LimitationModel](#limitationmodel) | | Yes |
|
|
| education | [EducationModel](#educationmodel) | | Yes |
|
|
| human_input_email_delivery_enabled | boolean | | Yes |
|
|
| is_allow_transfer_workspace | boolean, <br>**Default:** true | | Yes |
|
|
| knowledge_pipeline | [KnowledgePipeline](#knowledgepipeline) | | Yes |
|
|
| knowledge_rate_limit | integer, <br>**Default:** 10 | | Yes |
|
|
| members | [LimitationModel](#limitationmodel) | | Yes |
|
|
| model_load_balancing_enabled | boolean | | Yes |
|
|
| next_credit_reset_date | integer | | Yes |
|
|
| trigger_event | [Quota](#quota) | | Yes |
|
|
| vector_space | [LimitationModel](#limitationmodel) | | Yes |
|
|
| webapp_copyright_enabled | boolean | | Yes |
|
|
| workspace_members | [LicenseLimitationModel](#licenselimitationmodel) | | Yes |
|
|
|
|
#### Feedback
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | No |
|
|
| from_account | [SimpleAccount](#simpleaccount) | | No |
|
|
| from_end_user_id | string | | No |
|
|
| from_source | string | | Yes |
|
|
| rating | string | | Yes |
|
|
|
|
#### FeedbackExportQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| end_date | string | End date (YYYY-MM-DD) | No |
|
|
| format | string, <br>**Available values:** "csv", "json", <br>**Default:** csv | Export format<br>*Enum:* `"csv"`, `"json"` | No |
|
|
| from_source | string | Filter by feedback source | No |
|
|
| has_comment | boolean | Only include feedback with comments | No |
|
|
| rating | string | Filter by rating | No |
|
|
| start_date | string | Start date (YYYY-MM-DD) | No |
|
|
|
|
#### FeedbackStat
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| dislike | integer | | Yes |
|
|
| like | integer | | Yes |
|
|
|
|
#### FetchFrom
|
|
|
|
Enum class for fetch from.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| FetchFrom | string | Enum class for fetch from. | |
|
|
|
|
#### FieldModelSchema
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| label | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | Yes |
|
|
| placeholder | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | No |
|
|
|
|
#### FileInfo
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| file_ids | [ string ] | | Yes |
|
|
|
|
#### FileInputConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allowed_file_extensions | [ string ] | | No |
|
|
| allowed_file_types | [ [FileType](#filetype) ] | | No |
|
|
| allowed_file_upload_methods | [ [FileTransferMethod](#filetransfermethod) ] | | No |
|
|
| output_variable_name | string | | Yes |
|
|
| type | string | | No |
|
|
|
|
#### FileListInputConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allowed_file_extensions | [ string ] | | No |
|
|
| allowed_file_types | [ [FileType](#filetype) ] | | No |
|
|
| allowed_file_upload_methods | [ [FileTransferMethod](#filetransfermethod) ] | | No |
|
|
| number_limits | integer | | No |
|
|
| output_variable_name | string | | Yes |
|
|
| type | string | | No |
|
|
|
|
#### FileResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_id | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| extension | string | | No |
|
|
| file_key | string | | No |
|
|
| id | string | | Yes |
|
|
| mime_type | string | | No |
|
|
| name | string | | Yes |
|
|
| original_url | string | | No |
|
|
| preview_url | string | | No |
|
|
| reference | string | | No |
|
|
| size | integer | | Yes |
|
|
| source_url | string | | No |
|
|
| tenant_id | string | | No |
|
|
| user_id | string | | No |
|
|
|
|
#### FileTransferMethod
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| FileTransferMethod | string | | |
|
|
|
|
#### FileType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| FileType | string | | |
|
|
|
|
#### FileWithSignedUrl
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | Yes |
|
|
| created_by | string | | Yes |
|
|
| extension | string | | Yes |
|
|
| id | string | | Yes |
|
|
| mime_type | string | | Yes |
|
|
| name | string | | Yes |
|
|
| size | integer | | Yes |
|
|
| url | string | | Yes |
|
|
|
|
#### ForgotPasswordCheckPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | | Yes |
|
|
| email | string | | Yes |
|
|
| token | string | | Yes |
|
|
|
|
#### ForgotPasswordCheckResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | Email address | Yes |
|
|
| is_valid | boolean | Whether code is valid | Yes |
|
|
| token | string | New reset token | Yes |
|
|
|
|
#### ForgotPasswordEmailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | Error code if account not found | No |
|
|
| data | string | Reset token | No |
|
|
| result | string | Operation result | Yes |
|
|
|
|
#### ForgotPasswordResetPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| new_password | string | | Yes |
|
|
| password_confirm | string | | Yes |
|
|
| token | string | | Yes |
|
|
|
|
#### ForgotPasswordResetResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | Operation result | Yes |
|
|
|
|
#### ForgotPasswordSendPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | Yes |
|
|
| language | string | | No |
|
|
|
|
#### FormInputConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| FormInputConfig | [ParagraphInputConfig](#paragraphinputconfig)<br>[SelectInputConfig](#selectinputconfig)<br>[FileInputConfig](#fileinputconfig)<br>[FileListInputConfig](#filelistinputconfig) | | |
|
|
|
|
#### FormOption
|
|
|
|
Model class for form option.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| label | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | Yes |
|
|
| show_on | [ [FormShowOnObject](#formshowonobject) ], <br>**Default:** | | No |
|
|
| value | string | | Yes |
|
|
|
|
#### FormShowOnObject
|
|
|
|
Model class for form show on.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| value | string | | Yes |
|
|
| variable | string | | Yes |
|
|
|
|
#### FormType
|
|
|
|
Enum class for form type.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| FormType | string | Enum class for form type. | |
|
|
|
|
#### GenerateSummaryPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| document_list | [ string ] | | Yes |
|
|
|
|
#### GeneratedAppResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| GeneratedAppResponse | | | |
|
|
|
|
#### GeneratorResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| GeneratorResponse | | | |
|
|
|
|
#### Github
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| github_plugin_unique_identifier | string | | Yes |
|
|
| package | string | | Yes |
|
|
| repo | string | | Yes |
|
|
| version | string | | Yes |
|
|
|
|
#### HitTestingChildChunk
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | Yes |
|
|
| id | string | | Yes |
|
|
| position | integer | | Yes |
|
|
| score | number | | Yes |
|
|
|
|
#### HitTestingDocument
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data_source_type | string | | Yes |
|
|
| doc_metadata | | | Yes |
|
|
| doc_type | string | | Yes |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### HitTestingFile
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| extension | string | | Yes |
|
|
| id | string | | Yes |
|
|
| mime_type | string | | Yes |
|
|
| name | string | | Yes |
|
|
| size | integer | | Yes |
|
|
| source_url | string | | Yes |
|
|
|
|
#### HitTestingPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| attachment_ids | [ string ] | List of attachment IDs to include in the retrieval context. | No |
|
|
| external_retrieval_model | object | Retrieval settings for external knowledge bases. | No |
|
|
| query | string | Search query text. | Yes |
|
|
| retrieval_model | [RetrievalModel](#retrievalmodel) | Retrieval model configuration. Controls how chunks are searched and ranked. | No |
|
|
|
|
#### HitTestingQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | Yes |
|
|
|
|
#### HitTestingRecord
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| child_chunks | [ [HitTestingChildChunk](#hittestingchildchunk) ] | | Yes |
|
|
| files | [ [HitTestingFile](#hittestingfile) ] | | Yes |
|
|
| score | number | | Yes |
|
|
| segment | [HitTestingSegment](#hittestingsegment) | | Yes |
|
|
| summary | string | | Yes |
|
|
| tsne_position | | | Yes |
|
|
|
|
#### HitTestingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| query | [HitTestingQuery](#hittestingquery) | | Yes |
|
|
| records | [ [HitTestingRecord](#hittestingrecord) ] | | Yes |
|
|
|
|
#### HitTestingSegment
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | Yes |
|
|
| completed_at | integer | | Yes |
|
|
| content | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| created_by | string | | Yes |
|
|
| disabled_at | integer | | Yes |
|
|
| disabled_by | string | | Yes |
|
|
| document | [HitTestingDocument](#hittestingdocument) | | Yes |
|
|
| document_id | string | | Yes |
|
|
| enabled | boolean | | Yes |
|
|
| error | string | | Yes |
|
|
| hit_count | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| index_node_hash | string | | Yes |
|
|
| index_node_id | string | | Yes |
|
|
| indexing_at | integer | | Yes |
|
|
| keywords | [ string ] | | Yes |
|
|
| position | integer | | Yes |
|
|
| sign_content | string | | Yes |
|
|
| status | string | | Yes |
|
|
| stopped_at | integer | | Yes |
|
|
| tokens | integer | | Yes |
|
|
| word_count | integer | | Yes |
|
|
|
|
#### HumanInputContent
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| form_definition | [HumanInputFormDefinition](#humaninputformdefinition) | | No |
|
|
| form_submission_data | [HumanInputFormSubmissionData](#humaninputformsubmissiondata) | | No |
|
|
| submitted | boolean | | Yes |
|
|
| type | [ExecutionContentType](#executioncontenttype) | | No |
|
|
| workflow_run_id | string | | Yes |
|
|
|
|
#### HumanInputDeliveryTestPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| delivery_method_id | string | Delivery method ID | Yes |
|
|
| inputs | object | Values used to fill missing upstream variables referenced in form_content | No |
|
|
|
|
#### HumanInputFormDefinition
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| actions | [ [UserActionConfig](#useractionconfig) ] | | No |
|
|
| display_in_ui | boolean | | No |
|
|
| expiration_time | integer | | Yes |
|
|
| form_content | string | | Yes |
|
|
| form_id | string | | Yes |
|
|
| form_token | string | | No |
|
|
| inputs | [ [FormInputConfig](#forminputconfig) ] | | No |
|
|
| node_id | string | | Yes |
|
|
| node_title | string | | Yes |
|
|
| resolved_default_values | object | | No |
|
|
|
|
#### HumanInputFormPreviewPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| inputs | object | Values used to fill missing upstream variables referenced in form_content | No |
|
|
|
|
#### HumanInputFormPreviewResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| actions | [ object ] | | No |
|
|
| display_in_ui | boolean | | No |
|
|
| expiration_time | integer | | No |
|
|
| form_content | string | | Yes |
|
|
| form_id | string | | Yes |
|
|
| form_token | string | | No |
|
|
| inputs | [ object ] | | No |
|
|
| node_id | string | | Yes |
|
|
| node_title | string | | Yes |
|
|
| resolved_default_values | object | | No |
|
|
|
|
#### HumanInputFormSubmissionData
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| action_id | string | | Yes |
|
|
| action_text | string | | Yes |
|
|
| node_id | string | | Yes |
|
|
| node_title | string | | Yes |
|
|
| rendered_content | string | | Yes |
|
|
| submitted_data | object | | No |
|
|
|
|
#### HumanInputFormSubmitPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| action | string | Selected action ID | Yes |
|
|
| form_inputs | object | Values the user provides for the form's own fields | Yes |
|
|
| inputs | object | Values used to fill missing upstream variables referenced in form_content | Yes |
|
|
|
|
#### HumanInputFormSubmitResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| HumanInputFormSubmitResponse | object | | |
|
|
|
|
#### HumanInputPauseTypeResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| backstage_input_url | string | | No |
|
|
| form_id | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### I18nObject
|
|
|
|
Model class for i18n object.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| en_US | string | | Yes |
|
|
| ja_JP | string | | No |
|
|
| pt_BR | string | | No |
|
|
| zh_Hans | string | | No |
|
|
|
|
#### IconInfo
|
|
|
|
Icon information model.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| icon_url | string | | No |
|
|
|
|
#### IconType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| IconType | string | | |
|
|
|
|
#### IdentityMode
|
|
|
|
How Dify forwards the end-user's identity to an MCP server.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| IdentityMode | string | How Dify forwards the end-user's identity to an MCP server. | |
|
|
|
|
#### Import
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string | | No |
|
|
| app_mode | string | | No |
|
|
| current_dsl_version | string, <br>**Default:** 0.7.0 | | No |
|
|
| error | string | | No |
|
|
| id | string | | Yes |
|
|
| imported_dsl_version | string | | No |
|
|
| permission_keys | [ string ] | | No |
|
|
| status | [ImportStatus](#importstatus) | | Yes |
|
|
| warnings | [ [DslImportWarning](#dslimportwarning) ] | | No |
|
|
|
|
#### ImportStatus
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ImportStatus | string | | |
|
|
|
|
#### IncludeSecretQuery
|
|
|
|
Query parameter for including secret variables in export.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| include_secret | string, <br>**Default:** false | Whether to include secret variables | No |
|
|
|
|
#### IndexingEstimate
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| preview | [ [PreviewDetail](#previewdetail) ] | | Yes |
|
|
| qa_preview | [ [QAPreviewDetail](#qapreviewdetail) ] | | No |
|
|
| total_segments | integer | | Yes |
|
|
|
|
#### IndexingEstimatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| dataset_id | string | | No |
|
|
| doc_form | string, <br>**Default:** text_model | | No |
|
|
| doc_language | string, <br>**Default:** English | | No |
|
|
| indexing_technique | string | | Yes |
|
|
| info_list | object | | Yes |
|
|
| process_rule | object | | Yes |
|
|
|
|
#### IndexingEstimateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| currency | string | | Yes |
|
|
| preview | [ [PreviewDetail](#previewdetail) ] | | Yes |
|
|
| qa_preview | [ [QAPreviewDetail](#qapreviewdetail) ] | | No |
|
|
| tokens | integer | | Yes |
|
|
| total_price | number<br>integer | | Yes |
|
|
| total_segments | integer | | Yes |
|
|
|
|
#### InfoList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data_source_type | string, <br>**Available values:** "notion_import", "upload_file", "website_crawl" | *Enum:* `"notion_import"`, `"upload_file"`, `"website_crawl"` | Yes |
|
|
| file_info_list | [FileInfo](#fileinfo) | | No |
|
|
| notion_info_list | [ [NotionInfo](#notioninfo) ] | | No |
|
|
| website_info_list | [WebsiteInfo](#websiteinfo) | | No |
|
|
|
|
#### Inner
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| model | string | | No |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
| provider | string | | No |
|
|
|
|
#### InputFieldDefinition
|
|
|
|
Input field definition for snippet parameters.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| default | string | | No |
|
|
| hint | boolean | | No |
|
|
| label | string | | No |
|
|
| max_length | integer | | No |
|
|
| options | [ string ] | | No |
|
|
| placeholder | string | | No |
|
|
| required | boolean | | No |
|
|
| type | string | | No |
|
|
|
|
#### InstalledAppCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string | | Yes |
|
|
|
|
#### InstalledAppInfoResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| icon_url | string | | Yes |
|
|
| id | string | | Yes |
|
|
| mode | string | | No |
|
|
| name | string | | No |
|
|
| use_icon_as_answer_icon | boolean | | No |
|
|
|
|
#### InstalledAppListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| installed_apps | [ [InstalledAppResponse](#installedappresponse) ] | | Yes |
|
|
|
|
#### InstalledAppResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app | [InstalledAppInfoResponse](#installedappinforesponse) | | Yes |
|
|
| app_owner_tenant_id | string | | Yes |
|
|
| editable | boolean | | Yes |
|
|
| id | string | | Yes |
|
|
| is_pinned | boolean | | Yes |
|
|
| last_used_at | integer | | No |
|
|
| uninstallable | boolean | | Yes |
|
|
|
|
#### InstalledAppUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| is_pinned | boolean | | No |
|
|
|
|
#### InstalledAppsListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string | App ID to filter by | No |
|
|
|
|
#### InstructionGeneratePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| current | string | Current instruction text | No |
|
|
| flow_id | string | Workflow/Flow ID | Yes |
|
|
| ideal_output | string | Expected ideal output | No |
|
|
| instruction | string | Instruction for generation | Yes |
|
|
| language | string, <br>**Default:** javascript | Programming language (javascript/python) | No |
|
|
| model_config | [ModelConfig](#modelconfig) | Model configuration | Yes |
|
|
| node_id | string | Node ID for workflow context | No |
|
|
|
|
#### InstructionTemplatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| type | string | Instruction template type | Yes |
|
|
|
|
#### IterationNodeRunPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| inputs | object | | No |
|
|
|
|
#### JSONObject
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| JSONObject | object | | |
|
|
|
|
#### JSONValue
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| JSONValue | string<br>integer<br>number<br>boolean<br>object<br>[ object ] | | |
|
|
|
|
#### JSONValueType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| JSONValueType | | | |
|
|
|
|
#### JsonObject
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| JsonObject | object | | |
|
|
|
|
#### JsonValue
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| JsonValue | | | |
|
|
|
|
#### KnowledgeConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data_source | [DataSource](#datasource) | Document data source configuration. | No |
|
|
| doc_form | string, <br>**Available values:** "hierarchical_model", "qa_model", "text_model", <br>**Default:** text_model | `text_model` for standard text chunking, `hierarchical_model` for parent-child chunk structure, `qa_model` for question-answer pair extraction.<br>*Enum:* `"hierarchical_model"`, `"qa_model"`, `"text_model"` | No |
|
|
| doc_language | string, <br>**Default:** English | Language of the document for processing optimization. | No |
|
|
| duplicate | boolean, <br>**Default:** true | Whether duplicate document content is allowed. | No |
|
|
| embedding_model | string | Embedding model name. Use the `model` field from [Get Available Models](/api-reference/models/get-available-models) with `model_type=text-embedding`. | No |
|
|
| embedding_model_provider | string | Embedding model provider. Use the `provider` field from [Get Available Models](/api-reference/models/get-available-models) with `model_type=text-embedding`. | No |
|
|
| indexing_technique | string, <br>**Available values:** "economy", "high_quality" | `high_quality` uses embedding models for precise search; `economy` uses keyword-based indexing. Required when adding the first document to a knowledge base; subsequent documents inherit the knowledge base's indexing technique if omitted.<br>*Enum:* `"economy"`, `"high_quality"` | Yes |
|
|
| is_multimodal | boolean | Whether the document uses multimodal indexing. | No |
|
|
| name | string | Document name. | No |
|
|
| original_document_id | string | Original document ID for replacement updates. | No |
|
|
| process_rule | [ProcessRule](#processrule) | Processing rules for chunking. | No |
|
|
| retrieval_model | [RetrievalModel](#retrievalmodel) | Retrieval model configuration. Controls how chunks are searched and ranked in this knowledge base. | No |
|
|
| summary_index_setting | object | Summary index configuration. | No |
|
|
|
|
#### KnowledgeFSAdmittedQueryRequest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| activeDocumentIds | [ string ] | | No |
|
|
| activeEntityIds | [ string ] | | No |
|
|
| knowledgeSpaceId | string | | Yes |
|
|
| mode | string | | No |
|
|
| query | string | | Yes |
|
|
| sessionId | string | | No |
|
|
|
|
#### KnowledgeFSAnswerTraceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | dateTime | | Yes |
|
|
| evidence_bundle_id | string | | No |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| mode | string, <br>**Available values:** "auto", "deep", "fast", "research" | *Enum:* `"auto"`, `"deep"`, `"fast"`, `"research"` | Yes |
|
|
| query | string | | Yes |
|
|
| steps | [ [KnowledgeFSAnswerTraceStepResponse](#knowledgefsanswertracestepresponse) ] | | Yes |
|
|
|
|
#### KnowledgeFSAnswerTraceStepResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ended_at | string | | No |
|
|
| metadata | object | | Yes |
|
|
| name | string | | Yes |
|
|
| started_at | dateTime | | Yes |
|
|
| status | string, <br>**Available values:** "error", "ok", "skipped" | *Enum:* `"error"`, `"ok"`, `"skipped"` | Yes |
|
|
|
|
#### KnowledgeFSAppBindingListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSAppBindingResponse](#knowledgefsappbindingresponse) ] | | Yes |
|
|
|
|
#### KnowledgeFSAppBindingPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string | | Yes |
|
|
| caller_kind | [KnowledgeFSAppSpaceJoinType](#knowledgefsappspacejointype) | | Yes |
|
|
|
|
#### KnowledgeFSAppBindingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string | | Yes |
|
|
| caller_kind | [KnowledgeFSAppSpaceJoinType](#knowledgefsappspacejointype) | | Yes |
|
|
| id | string | | Yes |
|
|
| revision | integer | | Yes |
|
|
| status | [KnowledgeFSAppSpaceJoinStatus](#knowledgefsappspacejoinstatus) | | Yes |
|
|
|
|
#### KnowledgeFSAppSpaceJoinStatus
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| KnowledgeFSAppSpaceJoinStatus | string | | |
|
|
|
|
#### KnowledgeFSAppSpaceJoinType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| KnowledgeFSAppSpaceJoinType | string | | |
|
|
|
|
#### KnowledgeFSBackgroundTaskListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cursor | string | | No |
|
|
| limit | integer, <br>**Default:** 50 | | No |
|
|
|
|
#### KnowledgeFSBackgroundTaskListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSBackgroundTaskResponse](#knowledgefsbackgroundtaskresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSBackgroundTaskResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| can_cancel | boolean | | Yes |
|
|
| can_retry | boolean | | Yes |
|
|
| completed_at | string | | No |
|
|
| created_at | dateTime | | Yes |
|
|
| document_id | string | | No |
|
|
| document_revision | integer | | No |
|
|
| error_code | string | | No |
|
|
| error_message | string | | No |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| operation | string, <br>**Available values:** "document_delete", "document_processing", "document_reindex", "document_upload", "source_bulk", "source_crawl_import", "source_crawl_preview", "source_online_document_import", "source_online_drive_import", "source_sync" | *Enum:* `"document_delete"`, `"document_processing"`, `"document_reindex"`, `"document_upload"`, `"source_bulk"`, `"source_crawl_import"`, `"source_crawl_preview"`, `"source_online_document_import"`, `"source_online_drive_import"`, `"source_sync"` | Yes |
|
|
| progress_completed | integer | | Yes |
|
|
| progress_failed | integer | | Yes |
|
|
| progress_percent | integer | | Yes |
|
|
| progress_total | integer | | Yes |
|
|
| source_id | string | | No |
|
|
| state | string, <br>**Available values:** "canceled", "completed", "failed", "queued", "running" | *Enum:* `"canceled"`, `"completed"`, `"failed"`, `"queued"`, `"running"` | Yes |
|
|
| task_kind | string, <br>**Available values:** "document", "document_bulk", "source" | *Enum:* `"document"`, `"document_bulk"`, `"source"` | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
|
|
#### KnowledgeFSBulkDeletionAcceptedItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| document_id | string | | Yes |
|
|
| job | [KnowledgeFSDurableDeletionJobResponse](#knowledgefsdurabledeletionjobresponse) | | Yes |
|
|
| status_url | string | | Yes |
|
|
|
|
#### KnowledgeFSBulkDeletionAcceptedResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [KnowledgeFSBulkDeletionAcceptedItemResponse](#knowledgefsbulkdeletionaccepteditemresponse) ] | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### KnowledgeFSBulkDocumentDeleteItemPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| documentId | string | | Yes |
|
|
| expectedRevision | integer | | Yes |
|
|
|
|
#### KnowledgeFSBulkDocumentDeletePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| documents | [ [KnowledgeFSBulkDocumentDeleteItemPayload](#knowledgefsbulkdocumentdeleteitempayload) ] | | Yes |
|
|
|
|
#### KnowledgeFSBulkJobResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| canceled_items | integer | | Yes |
|
|
| completed_items | integer | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| failed_item_ids | [ string ] | | Yes |
|
|
| failed_items | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| status | string, <br>**Available values:** "canceled", "completed", "failed", "running" | *Enum:* `"canceled"`, `"completed"`, `"failed"`, `"running"` | Yes |
|
|
| total_items | integer | | Yes |
|
|
| type | string, <br>**Available values:** "document_delete", "document_reindex", "document_upload" | *Enum:* `"document_delete"`, `"document_reindex"`, `"document_upload"` | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
|
|
#### KnowledgeFSCapabilityResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| direct_origin | string | | Yes |
|
|
| expires_at | dateTime | | Yes |
|
|
| operation_id | string, <br>**Available values:** "abortUploadSession", "completeUploadSession", "createUploadSession", "presignUploadSessionPart" | *Enum:* `"abortUploadSession"`, `"completeUploadSession"`, `"createUploadSession"`, `"presignUploadSessionPart"` | Yes |
|
|
| token | string | | Yes |
|
|
|
|
#### KnowledgeFSControlSpacePermissionRole
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| KnowledgeFSControlSpacePermissionRole | string | | |
|
|
|
|
#### KnowledgeFSControlSpaceState
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| KnowledgeFSControlSpaceState | string | | |
|
|
|
|
#### KnowledgeFSControlSpaceVisibility
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| KnowledgeFSControlSpaceVisibility | string | | |
|
|
|
|
#### KnowledgeFSCrawlPreviewPageListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cursor | string | | No |
|
|
| limit | integer, <br>**Default:** 50 | | No |
|
|
|
|
#### KnowledgeFSCrawlPreviewPageListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSCrawlPreviewPageResponse](#knowledgefscrawlpreviewpageresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSCrawlPreviewPageResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| etag | string | | No |
|
|
| page_id | string | | Yes |
|
|
| source_url | string | | Yes |
|
|
| title | string | | No |
|
|
|
|
#### KnowledgeFSCrawlPreviewSelectionPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| pageIds | [ string ] | | Yes |
|
|
|
|
#### KnowledgeFSCrawledPageResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | Yes |
|
|
| description | string | | No |
|
|
| source_url | string | | Yes |
|
|
| title | string | | No |
|
|
|
|
#### KnowledgeFSCredentialCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allowed_actions | [ string ] | | Yes |
|
|
| expires_at | string | | No |
|
|
|
|
#### KnowledgeFSCredentialCreateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allowed_actions | [ string ] | | Yes |
|
|
| credential | string | | Yes |
|
|
| credential_last4 | string | | Yes |
|
|
| credential_prefix | string | | Yes |
|
|
| expires_at | string | | Yes |
|
|
| id | string | | Yes |
|
|
| principal | string | | Yes |
|
|
|
|
#### KnowledgeFSCredentialItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allowed_actions | [ string ] | | Yes |
|
|
| credential_last4 | string | | Yes |
|
|
| credential_prefix | string | | Yes |
|
|
| expires_at | string | | Yes |
|
|
| id | string | | Yes |
|
|
| last_used_at | string | | Yes |
|
|
| principal | string | | Yes |
|
|
| revision | integer | | Yes |
|
|
| status | string | | Yes |
|
|
|
|
#### KnowledgeFSCredentialListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSCredentialItemResponse](#knowledgefscredentialitemresponse) ] | | Yes |
|
|
|
|
#### KnowledgeFSCursorQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cursor | string | | No |
|
|
|
|
#### KnowledgeFSDocumentChunkListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cursor | string | | No |
|
|
| query | string | | No |
|
|
|
|
#### KnowledgeFSDocumentChunkListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSDocumentChunkResponse](#knowledgefsdocumentchunkresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSDocumentChunkResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | dateTime | | Yes |
|
|
| document_id | string | | Yes |
|
|
| document_revision | integer | | Yes |
|
|
| enabled | boolean | | Yes |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| ordinal | integer | | Yes |
|
|
| parent_chunk_id | string | | No |
|
|
| text | string | | Yes |
|
|
| token_count | integer | | Yes |
|
|
| user_metadata | object | | Yes |
|
|
|
|
#### KnowledgeFSDocumentCompilationJobResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| base_head_revision | integer | | No |
|
|
| candidate_fingerprint | string | | No |
|
|
| candidate_publication_id | string | | No |
|
|
| completed_at | number | | No |
|
|
| created_at | number | | Yes |
|
|
| document_asset_id | string | | Yes |
|
|
| error | string | | No |
|
|
| execution_attempts | integer | | No |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| max_execution_attempts | integer | | No |
|
|
| run_state | string | | No |
|
|
| stage | string, <br>**Available values:** "canceled", "failed", "nodes_generated", "outline_built", "parsed", "projection_built", "published", "queued", "smoke_eval_passed" | *Enum:* `"canceled"`, `"failed"`, `"nodes_generated"`, `"outline_built"`, `"parsed"`, `"projection_built"`, `"published"`, `"queued"`, `"smoke_eval_passed"` | Yes |
|
|
| updated_at | number | | Yes |
|
|
| version | integer | | Yes |
|
|
|
|
#### KnowledgeFSDocumentDeletePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expectedRevision | integer | | Yes |
|
|
|
|
#### KnowledgeFSDocumentListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSDocumentResponse](#knowledgefsdocumentresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSDocumentMetadataPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expectedRowVersion | integer | | Yes |
|
|
| patch | object | | Yes |
|
|
|
|
#### KnowledgeFSDocumentOutlineNodeResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| child_node_ids | [ string ] | | No |
|
|
| children | [ object ] | | No |
|
|
| end_offset | integer | | No |
|
|
| end_page | integer | | No |
|
|
| id | string | | Yes |
|
|
| level | integer | | Yes |
|
|
| metadata | object | | Yes |
|
|
| section_path | [ string ] | | No |
|
|
| source_element_ids | [ string ] | | No |
|
|
| source_node_ids | [ string ] | | No |
|
|
| start_offset | integer | | No |
|
|
| start_page | integer | | No |
|
|
| summary | string | | No |
|
|
| title | string | | Yes |
|
|
| title_location | object | | No |
|
|
| toc_source | string | | Yes |
|
|
|
|
#### KnowledgeFSDocumentOutlineResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| artifact_hash | string | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| document_asset_id | string | | Yes |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| metadata | object | | Yes |
|
|
| nodes | [ [KnowledgeFSDocumentOutlineNodeResponse](#knowledgefsdocumentoutlinenoderesponse) ] | | Yes |
|
|
| outline_version | string | | Yes |
|
|
| parse_artifact_id | string | | Yes |
|
|
| updated_at | string | | No |
|
|
| version | integer | | Yes |
|
|
|
|
#### KnowledgeFSDocumentReindexItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| asset | [KnowledgeFSDocumentResponse](#knowledgefsdocumentresponse) | | No |
|
|
| compilation_job | object | | No |
|
|
| document_id | string | | No |
|
|
| status | string, <br>**Available values:** "not_found", "queued" | *Enum:* `"not_found"`, `"queued"` | Yes |
|
|
| status_url | string | | No |
|
|
|
|
#### KnowledgeFSDocumentReindexPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| all | boolean | | No |
|
|
| documentIds | [ string ] | | No |
|
|
|
|
#### KnowledgeFSDocumentReindexResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| bulk_job_id | string | | Yes |
|
|
| items | [ [KnowledgeFSDocumentReindexItemResponse](#knowledgefsdocumentreindexitemresponse) ] | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### KnowledgeFSDocumentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | dateTime | | Yes |
|
|
| filename | string | | Yes |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| metadata | object | | Yes |
|
|
| mime_type | string | | Yes |
|
|
| object_key | string | | Yes |
|
|
| parser_status | string, <br>**Available values:** "failed", "parsed", "pending" | *Enum:* `"failed"`, `"parsed"`, `"pending"` | Yes |
|
|
| sha256 | string | | Yes |
|
|
| size_bytes | integer | | Yes |
|
|
| source_id | string | | No |
|
|
| updated_at | string | | No |
|
|
| version | integer | | Yes |
|
|
|
|
#### KnowledgeFSDocumentRevisionListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSDocumentRevisionResponse](#knowledgefsdocumentrevisionresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSDocumentRevisionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| activated_at | string | | No |
|
|
| content_hash | string | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| document_asset_id | string | | Yes |
|
|
| document_asset_version | integer | | Yes |
|
|
| document_id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| mime_type | string | | Yes |
|
|
| revision | integer | | Yes |
|
|
| size_bytes | integer | | Yes |
|
|
| state | string, <br>**Available values:** "active", "candidate", "failed", "superseded" | *Enum:* `"active"`, `"candidate"`, `"failed"`, `"superseded"` | Yes |
|
|
|
|
#### KnowledgeFSDocumentUploadAcceptedResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| asset | [KnowledgeFSDocumentResponse](#knowledgefsdocumentresponse) | | Yes |
|
|
| asset_status_url | string | | No |
|
|
| compilation_job | [KnowledgeFSDocumentUploadCompilationJobResponse](#knowledgefsdocumentuploadcompilationjobresponse) | | Yes |
|
|
| document_revision | integer | | Yes |
|
|
| logical_document | [KnowledgeFSDocumentUploadLogicalDocumentResponse](#knowledgefsdocumentuploadlogicaldocumentresponse) | | Yes |
|
|
| logical_document_id | string | | Yes |
|
|
| status | string | | No |
|
|
| status_url | string | | Yes |
|
|
|
|
#### KnowledgeFSDocumentUploadCompilationJobResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| stage | string | | Yes |
|
|
|
|
#### KnowledgeFSDocumentUploadLogicalDocumentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| revision | integer | | Yes |
|
|
|
|
#### KnowledgeFSDurableDeletionAcceptedResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| job | [KnowledgeFSDurableDeletionJobResponse](#knowledgefsdurabledeletionjobresponse) | | Yes |
|
|
| status_url | string | | Yes |
|
|
|
|
#### KnowledgeFSDurableDeletionErrorResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | | Yes |
|
|
| message | string | | Yes |
|
|
| retryable | boolean | | Yes |
|
|
|
|
#### KnowledgeFSDurableDeletionJobResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| checkpoint | string, <br>**Available values:** "completed", "deleting_derived_data", "deleting_objects", "deleting_primary_data", "quiescing", "requested" | *Enum:* `"completed"`, `"deleting_derived_data"`, `"deleting_objects"`, `"deleting_primary_data"`, `"quiescing"`, `"requested"` | Yes |
|
|
| completed_at | string | | No |
|
|
| created_at | dateTime | | Yes |
|
|
| error | [KnowledgeFSDurableDeletionErrorResponse](#knowledgefsdurabledeletionerrorresponse) | | No |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| mode | string | | No |
|
|
| progress | [KnowledgeFSDurableDeletionProgressResponse](#knowledgefsdurabledeletionprogressresponse) | | No |
|
|
| retry_at | string | | No |
|
|
| run_state | string, <br>**Available values:** "canceled", "completed", "dispatch_pending", "failed", "queued", "retry_wait", "running" | *Enum:* `"canceled"`, `"completed"`, `"dispatch_pending"`, `"failed"`, `"queued"`, `"retry_wait"`, `"running"` | Yes |
|
|
| target_id | string | | Yes |
|
|
| target_type | string, <br>**Available values:** "document", "knowledge_space", "logical_document", "source" | *Enum:* `"document"`, `"knowledge_space"`, `"logical_document"`, `"source"` | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
|
|
#### KnowledgeFSDurableDeletionProgressResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| completed_items | integer | | Yes |
|
|
| current_item_kind | string | | No |
|
|
| total_items | integer | | No |
|
|
|
|
#### KnowledgeFSEmbeddingSettingsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| dimension | integer | | No |
|
|
| model | string | | Yes |
|
|
| plugin_id | string | | Yes |
|
|
| provider | string | | Yes |
|
|
| revision | integer | | No |
|
|
| vector_space_id | string | | No |
|
|
|
|
#### KnowledgeFSExternalAccessPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_enabled | boolean | | Yes |
|
|
| mcp_enabled | boolean | | No |
|
|
| service_api_enabled | boolean | | Yes |
|
|
| workflow_enabled | boolean | | Yes |
|
|
|
|
#### KnowledgeFSExternalAccessResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_enabled | boolean | | Yes |
|
|
| mcp_enabled | boolean | | Yes |
|
|
| revision | integer | | Yes |
|
|
| service_api_enabled | boolean | | Yes |
|
|
| workflow_enabled | boolean | | Yes |
|
|
|
|
#### KnowledgeFSJWKResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| alg | string | | Yes |
|
|
| e | string | | Yes |
|
|
| kid | string | | Yes |
|
|
| kty | string | | Yes |
|
|
| n | string | | Yes |
|
|
| use | string | | Yes |
|
|
|
|
#### KnowledgeFSJWKSResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keys | [ [KnowledgeFSJWKResponse](#knowledgefsjwkresponse) ] | | Yes |
|
|
|
|
#### KnowledgeFSLogicalDocumentListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSLogicalDocumentResponse](#knowledgefslogicaldocumentresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSLogicalDocumentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| active | [KnowledgeFSDocumentRevisionResponse](#knowledgefsdocumentrevisionresponse) | | Yes |
|
|
| active_revision | integer | | No |
|
|
| created_at | dateTime | | Yes |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| provider_item_id | string | | No |
|
|
| row_version | integer | | Yes |
|
|
| source_id | string | | No |
|
|
| status | string, <br>**Available values:** "deleting", "failed", "pending", "ready" | *Enum:* `"deleting"`, `"failed"`, `"pending"`, `"ready"` | Yes |
|
|
| title | string | | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
| user_metadata | object | | Yes |
|
|
|
|
#### KnowledgeFSMemberBindingPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| account_id | string | | Yes |
|
|
| role | [KnowledgeFSControlSpacePermissionRole](#knowledgefscontrolspacepermissionrole) | | Yes |
|
|
|
|
#### KnowledgeFSMembersReplacePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| members | [ [KnowledgeFSMemberBindingPayload](#knowledgefsmemberbindingpayload) ] | | Yes |
|
|
|
|
#### KnowledgeFSModelIntent
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| model | string | | Yes |
|
|
| plugin_id | string | | Yes |
|
|
| provider | string | | Yes |
|
|
|
|
#### KnowledgeFSOnlineDocumentWorkflowImportItemPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| etag | string | | No |
|
|
| lastEditedTime | string | | No |
|
|
| name | string | | No |
|
|
| pageId | string | | Yes |
|
|
| providerItemId | string | | Yes |
|
|
| type | string | | Yes |
|
|
| workspaceId | string | | Yes |
|
|
|
|
#### KnowledgeFSOnlineDocumentWorkflowImportPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [KnowledgeFSOnlineDocumentWorkflowImportItemPayload](#knowledgefsonlinedocumentworkflowimportitempayload) ] | | Yes |
|
|
| kind | string | | Yes |
|
|
|
|
#### KnowledgeFSOnlineDriveWorkflowImportItemPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| bucket | string | | No |
|
|
| etag | string | | No |
|
|
| id | string | | Yes |
|
|
| mimeType | string | | No |
|
|
| name | string | | Yes |
|
|
| providerItemId | string | | Yes |
|
|
|
|
#### KnowledgeFSOnlineDriveWorkflowImportPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [KnowledgeFSOnlineDriveWorkflowImportItemPayload](#knowledgefsonlinedriveworkflowimportitempayload) ] | | Yes |
|
|
| kind | string | | Yes |
|
|
|
|
#### KnowledgeFSOverviewCountComparisonResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| change_rate | number | | Yes |
|
|
| previous_value | integer | | Yes |
|
|
| value | integer | | Yes |
|
|
|
|
#### KnowledgeFSOverviewHealthComponentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| codes | [ string ] | | Yes |
|
|
| state | string, <br>**Available values:** "degraded", "healthy", "unavailable", "unknown" | *Enum:* `"degraded"`, `"healthy"`, `"unavailable"`, `"unknown"` | Yes |
|
|
|
|
#### KnowledgeFSOverviewHealthComponentsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| index | [KnowledgeFSOverviewHealthComponentResponse](#knowledgefsoverviewhealthcomponentresponse) | | Yes |
|
|
| ingestion | [KnowledgeFSOverviewHealthComponentResponse](#knowledgefsoverviewhealthcomponentresponse) | | Yes |
|
|
| profile_publication | [KnowledgeFSOverviewHealthComponentResponse](#knowledgefsoverviewhealthcomponentresponse) | | Yes |
|
|
| query_availability | [KnowledgeFSOverviewHealthComponentResponse](#knowledgefsoverviewhealthcomponentresponse) | | Yes |
|
|
| source_freshness | [KnowledgeFSOverviewHealthComponentResponse](#knowledgefsoverviewhealthcomponentresponse) | | Yes |
|
|
| worker_readiness | [KnowledgeFSOverviewHealthComponentResponse](#knowledgefsoverviewhealthcomponentresponse) | | Yes |
|
|
|
|
#### KnowledgeFSOverviewHealthResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| components | [KnowledgeFSOverviewHealthComponentsResponse](#knowledgefsoverviewhealthcomponentsresponse) | | Yes |
|
|
| generated_at | dateTime | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| state | string, <br>**Available values:** "degraded", "healthy", "unavailable", "unknown" | *Enum:* `"degraded"`, `"healthy"`, `"unavailable"`, `"unknown"` | Yes |
|
|
|
|
#### KnowledgeFSOverviewIndexCoverageResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| indexed | integer | | Yes |
|
|
| percentage | number | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### KnowledgeFSOverviewInventoryDeltaResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| added_last_7d | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### KnowledgeFSOverviewInventoryResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| generated_at | dateTime | | Yes |
|
|
| graph_entities | [KnowledgeFSOverviewInventoryDeltaResponse](#knowledgefsoverviewinventorydeltaresponse) | | Yes |
|
|
| graph_relations | [KnowledgeFSOverviewInventoryDeltaResponse](#knowledgefsoverviewinventorydeltaresponse) | | Yes |
|
|
| index_coverage | [KnowledgeFSOverviewIndexCoverageResponse](#knowledgefsoverviewindexcoverageresponse) | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| source_categories | [KnowledgeFSOverviewSourceCategoriesResponse](#knowledgefsoverviewsourcecategoriesresponse) | | Yes |
|
|
|
|
#### KnowledgeFSOverviewQueryOutcomeBucketResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answered | integer | | Yes |
|
|
| end_at | dateTime | | Yes |
|
|
| low_confidence | integer | | Yes |
|
|
| no_evidence | integer | | Yes |
|
|
| query_count | integer | | Yes |
|
|
| start_at | dateTime | | Yes |
|
|
|
|
#### KnowledgeFSOverviewQueryOutcomeCountsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer_rate | number | | Yes |
|
|
| answered | integer | | Yes |
|
|
| low_confidence | integer | | Yes |
|
|
| no_evidence | integer | | Yes |
|
|
| query_count | integer | | Yes |
|
|
|
|
#### KnowledgeFSOverviewQueryOutcomesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| buckets | [ [KnowledgeFSOverviewQueryOutcomeBucketResponse](#knowledgefsoverviewqueryoutcomebucketresponse) ] | | Yes |
|
|
| current | [KnowledgeFSOverviewQueryOutcomeCountsResponse](#knowledgefsoverviewqueryoutcomecountsresponse) | | Yes |
|
|
| generated_at | dateTime | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| previous | [KnowledgeFSOverviewQueryOutcomeCountsResponse](#knowledgefsoverviewqueryoutcomecountsresponse) | | Yes |
|
|
| previous_since | dateTime | | Yes |
|
|
| since | dateTime | | Yes |
|
|
| window | string, <br>**Available values:** "24h", "30d", "7d" | *Enum:* `"24h"`, `"30d"`, `"7d"` | Yes |
|
|
|
|
#### KnowledgeFSOverviewRateComparisonResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| change_percentage_points | number | | Yes |
|
|
| previous_value | number | | Yes |
|
|
| value | number | | Yes |
|
|
|
|
#### KnowledgeFSOverviewSourceCategoriesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| crawl | integer | | Yes |
|
|
| online_documents | integer | | Yes |
|
|
| online_drives | integer | | Yes |
|
|
| uploads | integer | | Yes |
|
|
|
|
#### KnowledgeFSOverviewStatsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer_rate | [KnowledgeFSOverviewRateComparisonResponse](#knowledgefsoverviewratecomparisonresponse) | | Yes |
|
|
| documents | integer | | Yes |
|
|
| fresh_source_count | integer | | Yes |
|
|
| freshness_seconds | integer | | No |
|
|
| generated_at | dateTime | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| latest_source_sync_at | string | | No |
|
|
| linked_apps | integer | | Yes |
|
|
| queries | [KnowledgeFSOverviewCountComparisonResponse](#knowledgefsoverviewcountcomparisonresponse) | | Yes |
|
|
| source_count | integer | | Yes |
|
|
| stale_source_count | integer | | Yes |
|
|
| window | string, <br>**Available values:** "24h", "30d", "7d" | *Enum:* `"24h"`, `"30d"`, `"7d"` | Yes |
|
|
|
|
#### KnowledgeFSOverviewWindowQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| window | string, <br>**Available values:** "24h", "30d", "7d", <br>**Default:** 24h | *Enum:* `"24h"`, `"30d"`, `"7d"` | No |
|
|
|
|
#### KnowledgeFSPermissionListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSPermissionResponse](#knowledgefspermissionresponse) ] | | Yes |
|
|
|
|
#### KnowledgeFSPermissionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| account_id | string | | Yes |
|
|
| revision | integer | | Yes |
|
|
| role | [KnowledgeFSControlSpacePermissionRole](#knowledgefscontrolspacepermissionrole) | | Yes |
|
|
| status | string | | Yes |
|
|
|
|
#### KnowledgeFSProductPermission
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| KnowledgeFSProductPermission | string | | |
|
|
|
|
#### KnowledgeFSProductRerankProfile
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | Yes |
|
|
| model | [KnowledgeFSProfileModelSelection](#knowledgefsprofilemodelselection) | | No |
|
|
|
|
#### KnowledgeFSProductRetrievalProfile
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| defaultMode | string, <br>**Available values:** "deep", "fast", "research" | *Enum:* `"deep"`, `"fast"`, `"research"` | Yes |
|
|
| reasoningModel | [KnowledgeFSProfileModelSelection](#knowledgefsprofilemodelselection) | | Yes |
|
|
| rerank | [KnowledgeFSProductRerankProfile](#knowledgefsproductrerankprofile) | | Yes |
|
|
| scoreThreshold | [KnowledgeFSProductScoreThreshold](#knowledgefsproductscorethreshold) | | Yes |
|
|
| topK | integer | | Yes |
|
|
|
|
#### KnowledgeFSProductScoreThreshold
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | Yes |
|
|
| stage | string, <br>**Available values:** "mode-final", "rerank", <br>**Default:** mode-final | *Enum:* `"mode-final"`, `"rerank"` | No |
|
|
| value | number | | No |
|
|
|
|
#### KnowledgeFSProfileModelSelection
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| model | string | | Yes |
|
|
| pluginId | string | | Yes |
|
|
| provider | string | | Yes |
|
|
|
|
#### KnowledgeFSQueryAdmissionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expires_at | dateTime | | Yes |
|
|
| operation_id | string | | Yes |
|
|
| request | [KnowledgeFSAdmittedQueryRequest](#knowledgefsadmittedqueryrequest) | | Yes |
|
|
| token | string | | Yes |
|
|
| url | string | | Yes |
|
|
|
|
#### KnowledgeFSQueryCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| activeDocumentIds | [ string ] | | No |
|
|
| activeEntityIds | [ string ] | | No |
|
|
| mode | string | | No |
|
|
| query | string | | Yes |
|
|
| sessionId | string | | No |
|
|
|
|
#### KnowledgeFSQueryResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | No |
|
|
| id | string | | Yes |
|
|
| status | string | | Yes |
|
|
| trace_id | string | | No |
|
|
|
|
#### KnowledgeFSQueryStreamCapabilityResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expires_at | dateTime | | Yes |
|
|
| operation_id | string | | Yes |
|
|
| token | string | | Yes |
|
|
| url | string | | Yes |
|
|
|
|
#### KnowledgeFSRerankIntent
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | Yes |
|
|
| model | [KnowledgeFSModelIntent](#knowledgefsmodelintent) | | No |
|
|
|
|
#### KnowledgeFSResearchTaskCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| budgetUsd | number | | No |
|
|
| limits | [KnowledgeFSResearchTaskLimits](#knowledgefsresearchtasklimits) | | No |
|
|
| metadata | object | | No |
|
|
| mode | string | | No |
|
|
| query | string | | Yes |
|
|
| topK | integer | | No |
|
|
|
|
#### KnowledgeFSResearchTaskLimits
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| maxRetrievalSteps | integer | | No |
|
|
| maxScannedResources | integer | | No |
|
|
| maxToolCalls | integer | | No |
|
|
| timeoutMs | integer | | No |
|
|
|
|
#### KnowledgeFSResearchTaskListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSResearchTaskResponse](#knowledgefsresearchtaskresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSResearchTaskPartialListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSResearchTaskPartialResponse](#knowledgefsresearchtaskpartialresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSResearchTaskPartialResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| evidence_bundle | object | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| research_task_job_id | string | | Yes |
|
|
| sequence | integer | | Yes |
|
|
|
|
#### KnowledgeFSResearchTaskPartialsQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cursor | string | | No |
|
|
| limit | integer, <br>**Default:** 25 | | No |
|
|
|
|
#### KnowledgeFSResearchTaskPlanBudgetResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| budget_usd | number | | No |
|
|
| exceeds_budget | boolean | | Yes |
|
|
| remaining_budget_usd | number | | No |
|
|
|
|
#### KnowledgeFSResearchTaskPlanPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| budgetUsd | number | | No |
|
|
| mode | string | | No |
|
|
| query | string | | Yes |
|
|
| topK | integer | | No |
|
|
|
|
#### KnowledgeFSResearchTaskPlanResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| budget | [KnowledgeFSResearchTaskPlanBudgetResponse](#knowledgefsresearchtaskplanbudgetresponse) | | Yes |
|
|
| estimates | object | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| query | string | | Yes |
|
|
| retrieval_plan | [KnowledgeFSResearchTaskRetrievalPlanResponse](#knowledgefsresearchtaskretrievalplanresponse) | | Yes |
|
|
| steps | [ object ] | | Yes |
|
|
| strategy_version | string | | Yes |
|
|
|
|
#### KnowledgeFSResearchTaskResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| budget_usd | number | | No |
|
|
| completed_at | number | | No |
|
|
| cost | object | | Yes |
|
|
| created_at | number | | Yes |
|
|
| error | string | | No |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| limits | [KnowledgeFSResearchTaskLimits](#knowledgefsresearchtasklimits) | | No |
|
|
| metadata | object | | Yes |
|
|
| mode | string | | No |
|
|
| query | string | | Yes |
|
|
| stage | string, <br>**Available values:** "analyzing", "canceled", "completed", "failed", "generating", "paused", "planning", "queued", "retrieving" | *Enum:* `"analyzing"`, `"canceled"`, `"completed"`, `"failed"`, `"generating"`, `"paused"`, `"planning"`, `"queued"`, `"retrieving"` | Yes |
|
|
| top_k | integer | | No |
|
|
| updated_at | number | | Yes |
|
|
|
|
#### KnowledgeFSResearchTaskRetrievalPlanResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| dense_top_k | integer | | Yes |
|
|
| fts_top_k | integer | | Yes |
|
|
| fusion_limit | integer | | Yes |
|
|
| query_language | string, <br>**Available values:** "cjk", "latin", "mixed-cjk-latin", "other" | *Enum:* `"cjk"`, `"latin"`, `"mixed-cjk-latin"`, `"other"` | Yes |
|
|
| requested_mode | string, <br>**Available values:** "auto", "deep", "fast", "research" | *Enum:* `"auto"`, `"deep"`, `"fast"`, `"research"` | Yes |
|
|
| rerank_candidate_limit | integer | | Yes |
|
|
| resolved_mode | string, <br>**Available values:** "deep", "fast", "research" | *Enum:* `"deep"`, `"fast"`, `"research"` | Yes |
|
|
| strategy_version | string | | Yes |
|
|
| top_k | integer | | Yes |
|
|
|
|
#### KnowledgeFSRetrievalProfileIntent
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| default_mode | string, <br>**Available values:** "deep", "fast", "research" | *Enum:* `"deep"`, `"fast"`, `"research"` | Yes |
|
|
| reasoning_model | [KnowledgeFSModelIntent](#knowledgefsmodelintent) | | Yes |
|
|
| rerank | [KnowledgeFSRerankIntent](#knowledgefsrerankintent) | | Yes |
|
|
| score_threshold | [KnowledgeFSScoreThresholdIntent](#knowledgefsscorethresholdintent) | | Yes |
|
|
| top_k | integer | | Yes |
|
|
|
|
#### KnowledgeFSRetrievalSettingsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| default_mode | string, <br>**Available values:** "deep", "fast", "research" | *Enum:* `"deep"`, `"fast"`, `"research"` | Yes |
|
|
| reasoning_model | [KnowledgeFSEmbeddingSettingsResponse](#knowledgefsembeddingsettingsresponse) | | Yes |
|
|
| rerank | [KnowledgeFSProductRerankProfile](#knowledgefsproductrerankprofile) | | Yes |
|
|
| revision | integer | | No |
|
|
| score_threshold | [KnowledgeFSProductScoreThreshold](#knowledgefsproductscorethreshold) | | Yes |
|
|
| top_k | integer | | Yes |
|
|
|
|
#### KnowledgeFSScoreThresholdIntent
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | Yes |
|
|
| stage | string, <br>**Available values:** "mode-final", "rerank", <br>**Default:** mode-final | *Enum:* `"mode-final"`, `"rerank"` | No |
|
|
| value | number | | No |
|
|
|
|
#### KnowledgeFSSettingsPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| embedding | [KnowledgeFSProfileModelSelection](#knowledgefsprofilemodelselection) | | No |
|
|
| expectedRevision | integer | | Yes |
|
|
| retrieval | [KnowledgeFSProductRetrievalProfile](#knowledgefsproductretrievalprofile) | | No |
|
|
|
|
#### KnowledgeFSSettingsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| configuration_state | string, <br>**Available values:** "active", "pending-validation", "setup-required", "validation-failed" | *Enum:* `"active"`, `"pending-validation"`, `"setup-required"`, `"validation-failed"` | Yes |
|
|
| embedding | [KnowledgeFSEmbeddingSettingsResponse](#knowledgefsembeddingsettingsresponse) | | Yes |
|
|
| retrieval | [KnowledgeFSRetrievalSettingsResponse](#knowledgefsretrievalsettingsresponse) | | Yes |
|
|
| revision | integer | | Yes |
|
|
|
|
#### KnowledgeFSSmallFileUploadResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| session | [KnowledgeFSUploadSessionResponse](#knowledgefsuploadsessionresponse) | | Yes |
|
|
|
|
#### KnowledgeFSSourceConnectionCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| authKind | string, <br>**Available values:** "api-key", "endpoint" | *Enum:* `"api-key"`, `"endpoint"` | Yes |
|
|
| configuration | object | | No |
|
|
| credentials | object | | Yes |
|
|
| name | string | | Yes |
|
|
| providerId | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceConnectionListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cursor | string | | No |
|
|
| limit | integer, <br>**Default:** 50 | | No |
|
|
|
|
#### KnowledgeFSSourceConnectionListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSSourceConnectionResponse](#knowledgefssourceconnectionresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSSourceConnectionRefreshPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expectedVersion | integer | | Yes |
|
|
|
|
#### KnowledgeFSSourceConnectionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| auth_kind | string, <br>**Available values:** "api-key", "endpoint", "oauth2" | *Enum:* `"api-key"`, `"endpoint"`, `"oauth2"` | Yes |
|
|
| configuration | object | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| error_code | string | | No |
|
|
| expires_at | string | | No |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| provider_id | string | | Yes |
|
|
| scopes | [ string ] | | Yes |
|
|
| status | string, <br>**Available values:** "active", "error", "expired", "provisioning", "revoked" | *Enum:* `"active"`, `"error"`, `"expired"`, `"provisioning"`, `"revoked"` | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
| version | integer | | Yes |
|
|
|
|
#### KnowledgeFSSourceCrawlResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| completed | integer | | No |
|
|
| failed | integer | | No |
|
|
| imported | integer | | No |
|
|
| pages | [ [KnowledgeFSCrawledPageResponse](#knowledgefscrawledpageresponse) ] | | Yes |
|
|
| replaced | integer | | No |
|
|
| skipped | integer | | No |
|
|
| status | string | | No |
|
|
| total | integer | | No |
|
|
|
|
#### KnowledgeFSSourceCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| connectionId | string | | No |
|
|
| credentials | object | | No |
|
|
| metadata | object | | No |
|
|
| name | string | | Yes |
|
|
| permissionScope | [ string ] | | No |
|
|
| status | string | | No |
|
|
| type | string, <br>**Available values:** "connector", "object-storage", "upload", "web" | *Enum:* `"connector"`, `"object-storage"`, `"upload"`, `"web"` | Yes |
|
|
| uri | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceCredentialTestResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | | No |
|
|
| error | string | | No |
|
|
| valid | boolean | | Yes |
|
|
|
|
#### KnowledgeFSSourceDeletePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expectedRevision | integer | | Yes |
|
|
|
|
#### KnowledgeFSSourceDeleteQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| documents | string, <br>**Available values:** "cascade", "keep", <br>**Default:** cascade | *Enum:* `"cascade"`, `"keep"` | No |
|
|
|
|
#### KnowledgeFSSourceFileBucketResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| bucket | string | | No |
|
|
| continuation_token | string | | No |
|
|
| files | [ [KnowledgeFSSourceFileResponse](#knowledgefssourcefileresponse) ] | | Yes |
|
|
| is_truncated | boolean | | No |
|
|
|
|
#### KnowledgeFSSourceFileResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| size | number | | No |
|
|
| type | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceFilesQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| bucket | string | | No |
|
|
| continuationToken | string | | No |
|
|
| maxKeys | integer | | No |
|
|
| prefix | string | | No |
|
|
|
|
#### KnowledgeFSSourceFilesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| buckets | [ [KnowledgeFSSourceFileBucketResponse](#knowledgefssourcefilebucketresponse) ] | | Yes |
|
|
|
|
#### KnowledgeFSSourceImportFailureResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | | Yes |
|
|
| error | string | | Yes |
|
|
| filename | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceImportFilePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| bucket | string | | No |
|
|
| id | string | | Yes |
|
|
| mimeType | string | | No |
|
|
| name | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceImportFilesPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ [KnowledgeFSSourceImportFilePayload](#knowledgefssourceimportfilepayload) ] | | Yes |
|
|
|
|
#### KnowledgeFSSourceImportPagePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| lastEditedTime | string | | No |
|
|
| name | string | | No |
|
|
| pageId | string | | Yes |
|
|
| type | string | | Yes |
|
|
| workspaceId | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceImportPagesPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| pages | [ [KnowledgeFSSourceImportPagePayload](#knowledgefssourceimportpagepayload) ] | | Yes |
|
|
|
|
#### KnowledgeFSSourceImportResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| documents | [ [KnowledgeFSSourceImportedDocumentResponse](#knowledgefssourceimporteddocumentresponse) ] | | Yes |
|
|
| failed | [ [KnowledgeFSSourceImportFailureResponse](#knowledgefssourceimportfailureresponse) ] | | Yes |
|
|
| skipped | [ string ] | | Yes |
|
|
|
|
#### KnowledgeFSSourceImportedDocumentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| document_asset_id | string | | Yes |
|
|
| filename | string | | Yes |
|
|
|
|
#### KnowledgeFSSourceListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSSourceResponse](#knowledgefssourceresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSSourcePageResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| last_edited_time | string | | No |
|
|
| page_id | string | | Yes |
|
|
| page_name | string | | Yes |
|
|
| parent_id | string | | No |
|
|
| type | string | | Yes |
|
|
|
|
#### KnowledgeFSSourcePagesQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cursor | string | | No |
|
|
| limit | integer, <br>**Default:** 50 | | No |
|
|
|
|
#### KnowledgeFSSourcePagesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| next_cursor | string | | No |
|
|
| workspaces | [ [KnowledgeFSSourceWorkspacePagesResponse](#knowledgefssourceworkspacepagesresponse) ] | | Yes |
|
|
|
|
#### KnowledgeFSSourceProviderFieldResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| format | string | | No |
|
|
| name | string | | Yes |
|
|
| required | boolean | | Yes |
|
|
| secret | boolean | | Yes |
|
|
| type | string, <br>**Available values:** "boolean", "integer", "string" | *Enum:* `"boolean"`, `"integer"`, `"string"` | Yes |
|
|
|
|
#### KnowledgeFSSourceProviderListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSSourceProviderResponse](#knowledgefssourceproviderresponse) ] | | Yes |
|
|
|
|
#### KnowledgeFSSourceProviderResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| auth_kinds | [ string, <br>**Available values:** "api-key", "endpoint", "oauth2" ] | | Yes |
|
|
| available | boolean | | Yes |
|
|
| capabilities | [ string, <br>**Available values:** "online-document", "online-drive", "website-crawl" ] | | Yes |
|
|
| configuration | [ [KnowledgeFSSourceProviderFieldResponse](#knowledgefssourceproviderfieldresponse) ] | | Yes |
|
|
| display_name | string | | Yes |
|
|
| id | string | | Yes |
|
|
| unavailable_reason | string | | No |
|
|
|
|
#### KnowledgeFSSourceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| connection_id | string | | No |
|
|
| created_at | dateTime | | Yes |
|
|
| credential_configured | boolean | | No |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| metadata | object | | Yes |
|
|
| name | string | | Yes |
|
|
| permission_scope | [ string ] | | Yes |
|
|
| status | string, <br>**Available values:** "active", "disabled", "error", "syncing" | *Enum:* `"active"`, `"disabled"`, `"error"`, `"syncing"` | Yes |
|
|
| type | string, <br>**Available values:** "connector", "object-storage", "upload", "web" | *Enum:* `"connector"`, `"object-storage"`, `"upload"`, `"web"` | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
| uri | string | | Yes |
|
|
| version | integer | | Yes |
|
|
|
|
#### KnowledgeFSSourceSyncPolicyPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| customIntervalSeconds | integer | | No |
|
|
| enabled | boolean | | Yes |
|
|
| expectedRevision | integer | | Yes |
|
|
| expectedSourceVersion | integer | | Yes |
|
|
| mode | string, <br>**Available values:** "custom", "interval", "manual", "provider" | *Enum:* `"custom"`, `"interval"`, `"manual"`, `"provider"` | Yes |
|
|
|
|
#### KnowledgeFSSourceSyncPolicyResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | dateTime | | Yes |
|
|
| custom_interval_seconds | integer | | No |
|
|
| enabled | boolean | | Yes |
|
|
| expected_source_version | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| mode | string, <br>**Available values:** "custom", "interval", "manual", "provider" | *Enum:* `"custom"`, `"interval"`, `"manual"`, `"provider"` | Yes |
|
|
| next_run_at | string | | No |
|
|
| revision | integer | | Yes |
|
|
| source_id | string | | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
|
|
#### KnowledgeFSSourceUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expectedVersion | integer | | No |
|
|
| metadata | object | | No |
|
|
| name | string | | No |
|
|
| status | string | | No |
|
|
|
|
#### KnowledgeFSSourceWorkflowCancelPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| reason | string | | No |
|
|
|
|
#### KnowledgeFSSourceWorkflowImportPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| KnowledgeFSSourceWorkflowImportPayload | [KnowledgeFSOnlineDocumentWorkflowImportPayload](#knowledgefsonlinedocumentworkflowimportpayload)<br>[KnowledgeFSOnlineDriveWorkflowImportPayload](#knowledgefsonlinedriveworkflowimportpayload) | | |
|
|
|
|
#### KnowledgeFSSourceWorkflowResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| canceled_at | string | | No |
|
|
| checkpoint | string | | Yes |
|
|
| completed_at | string | | No |
|
|
| created_at | dateTime | | Yes |
|
|
| cursor | string | | No |
|
|
| execution_attempts | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| kind | string | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| last_error_code | string | | No |
|
|
| max_execution_attempts | integer | | Yes |
|
|
| progress_completed | integer | | Yes |
|
|
| progress_failed | integer | | Yes |
|
|
| progress_skipped | integer | | Yes |
|
|
| progress_total | integer | | No |
|
|
| source_id | string | | No |
|
|
| state | string | | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
|
|
#### KnowledgeFSSourceWorkspacePagesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| pages | [ [KnowledgeFSSourcePageResponse](#knowledgefssourcepageresponse) ] | | Yes |
|
|
| total | integer | | No |
|
|
| workspace_id | string | | No |
|
|
| workspace_name | string | | No |
|
|
|
|
#### KnowledgeFSSpaceCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| embedding | [KnowledgeFSModelIntent](#knowledgefsmodelintent) | | Yes |
|
|
| icon | string | | No |
|
|
| idempotency_key | string | | No |
|
|
| name | string | | Yes |
|
|
| retrieval | [KnowledgeFSRetrievalProfileIntent](#knowledgefsretrievalprofileintent) | | Yes |
|
|
| slug | string | | Yes |
|
|
| visibility | [KnowledgeFSControlSpaceVisibility](#knowledgefscontrolspacevisibility) | | No |
|
|
|
|
#### KnowledgeFSSpaceCreateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| control_space_id | string | | Yes |
|
|
| operation_id | string | | Yes |
|
|
| state | [KnowledgeFSControlSpaceState](#knowledgefscontrolspacestate) | | Yes |
|
|
|
|
#### KnowledgeFSSpaceDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| control_space_id | string | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| owner_account_id | string | | Yes |
|
|
| permission_keys | [ [KnowledgeFSProductPermission](#knowledgefsproductpermission) ] | | Yes |
|
|
| resource_version | integer | | Yes |
|
|
| state | [KnowledgeFSControlSpaceState](#knowledgefscontrolspacestate) | | Yes |
|
|
| technical_status | string, <br>**Available values:** "available", "not_ready", "unavailable" | *Enum:* `"available"`, `"not_ready"`, `"unavailable"` | Yes |
|
|
| technical_summary | [KnowledgeFSTechnicalSummary](#knowledgefstechnicalsummary) | | No |
|
|
| updated_at | dateTime | | Yes |
|
|
| visibility | [KnowledgeFSControlSpaceVisibility](#knowledgefscontrolspacevisibility) | | Yes |
|
|
|
|
#### KnowledgeFSSpaceListItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| control_space_id | string | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| knowledge_space_id | string | | Yes |
|
|
| owner_account_id | string | | Yes |
|
|
| permission_keys | [ [KnowledgeFSProductPermission](#knowledgefsproductpermission) ] | | Yes |
|
|
| resource_version | integer | | Yes |
|
|
| state | [KnowledgeFSControlSpaceState](#knowledgefscontrolspacestate) | | Yes |
|
|
| technical_status | string, <br>**Available values:** "available", "not_ready", "unavailable" | *Enum:* `"available"`, `"not_ready"`, `"unavailable"` | Yes |
|
|
| technical_summary | [KnowledgeFSTechnicalSummary](#knowledgefstechnicalsummary) | | No |
|
|
| updated_at | dateTime | | Yes |
|
|
| visibility | [KnowledgeFSControlSpaceVisibility](#knowledgefscontrolspacevisibility) | | Yes |
|
|
|
|
#### KnowledgeFSSpaceListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| limit | integer, <br>**Default:** 20 | | No |
|
|
| page | integer, <br>**Default:** 1 | | No |
|
|
|
|
#### KnowledgeFSSpaceListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSSpaceListItemResponse](#knowledgefsspacelistitemresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
|
|
#### KnowledgeFSSpaceUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| icon | string | | No |
|
|
| name | string | | No |
|
|
| visibility | [KnowledgeFSControlSpaceVisibility](#knowledgefscontrolspacevisibility) | | No |
|
|
|
|
#### KnowledgeFSStreamCapabilityPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| control_space_id | string | | Yes |
|
|
|
|
#### KnowledgeFSStreamCapabilityResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expires_at | dateTime | | Yes |
|
|
| operation_id | string | | Yes |
|
|
| token | string | | Yes |
|
|
| url | string | | Yes |
|
|
|
|
#### KnowledgeFSTechnicalSummary
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| document_count | integer | | No |
|
|
| icon | string | | No |
|
|
| index_state | string | | No |
|
|
| knowledge_space_id | string | | Yes |
|
|
| last_job_state | string | | No |
|
|
| model_profile | object | | No |
|
|
| name | string | | Yes |
|
|
| revision | integer | | Yes |
|
|
| slug | string | | Yes |
|
|
|
|
#### KnowledgeFSTraceEntriesQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cursor | string | | No |
|
|
| limit | integer, <br>**Default:** 100 | | No |
|
|
|
|
#### KnowledgeFSTraceEntryListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| consistency_class | string | | No |
|
|
| data | [ [KnowledgeFSTraceEntryResponse](#knowledgefstraceentryresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
| path | string | | Yes |
|
|
| preview | boolean | | No |
|
|
| truncated | boolean | | Yes |
|
|
|
|
#### KnowledgeFSTraceEntryResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| kind | string, <br>**Available values:** "directory", "resource" | *Enum:* `"directory"`, `"resource"` | Yes |
|
|
| metadata | object | | Yes |
|
|
| name | string | | Yes |
|
|
| path | string | | Yes |
|
|
| resource_type | string | | No |
|
|
| target_id | string | | No |
|
|
| version | integer | | No |
|
|
|
|
#### KnowledgeFSTraceListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [KnowledgeFSTraceResponse](#knowledgefstraceresponse) ] | | Yes |
|
|
| next_cursor | string | | No |
|
|
|
|
#### KnowledgeFSTraceProfileResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| embedding_model | string | | No |
|
|
| embedding_vector_space_id | string | | No |
|
|
| projection_publication_id | string | | No |
|
|
| projection_version | integer | | No |
|
|
| reasoning_model | string | | No |
|
|
| rerank_model | string | | No |
|
|
| retrieval_profile_revision | integer | | No |
|
|
|
|
#### KnowledgeFSTraceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| completed | boolean | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| evidence_bundle_id | string | | No |
|
|
| evidence_state | string | | No |
|
|
| final_score | number | | No |
|
|
| id | string | | Yes |
|
|
| mode | string, <br>**Available values:** "auto", "deep", "fast", "research" | *Enum:* `"auto"`, `"deep"`, `"fast"`, `"research"` | Yes |
|
|
| profile | [KnowledgeFSTraceProfileResponse](#knowledgefstraceprofileresponse) | | Yes |
|
|
| query | string | | Yes |
|
|
| scores | [KnowledgeFSTraceScoresResponse](#knowledgefstracescoresresponse) | | Yes |
|
|
| stages | [ [KnowledgeFSTraceStageResponse](#knowledgefstracestageresponse) ] | | Yes |
|
|
|
|
#### KnowledgeFSTraceScoresResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| final | number | | No |
|
|
| rerank | number | | No |
|
|
| retrieval | number | | No |
|
|
|
|
#### KnowledgeFSTraceStageResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| candidate_count | integer | | No |
|
|
| name | string | | Yes |
|
|
| status | string, <br>**Available values:** "error", "ok", "skipped" | *Enum:* `"error"`, `"ok"`, `"skipped"` | Yes |
|
|
|
|
#### KnowledgeFSUploadCapabilityPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| operation_id | string, <br>**Available values:** "abortUploadSession", "completeUploadSession", "createUploadSession", "presignUploadSessionPart" | *Enum:* `"abortUploadSession"`, `"completeUploadSession"`, `"createUploadSession"`, `"presignUploadSessionPart"` | Yes |
|
|
| upload_session_id | string | | No |
|
|
|
|
#### KnowledgeFSUploadSessionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| compilation_job_id | string | | No |
|
|
| completed_at | integer | | No |
|
|
| document_asset_id | string | | No |
|
|
| expected_size_bytes | integer | | Yes |
|
|
| expires_at | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| mode | string, <br>**Available values:** "multipart", "single", "small_fallback" | *Enum:* `"multipart"`, `"single"`, `"small_fallback"` | Yes |
|
|
| multipart_part_count | integer | | No |
|
|
| multipart_part_size_bytes | integer | | No |
|
|
| status | string, <br>**Available values:** "aborted", "aborting", "completed", "completing", "creating", "expired", "failed", "ready" | *Enum:* `"aborted"`, `"aborting"`, `"completed"`, `"completing"`, `"creating"`, `"expired"`, `"failed"`, `"ready"` | Yes |
|
|
|
|
#### KnowledgePipeline
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| publish_enabled | boolean | | Yes |
|
|
|
|
#### LLMMode
|
|
|
|
Enum class for large language model mode.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| LLMMode | string | Enum class for large language model mode. | |
|
|
|
|
#### LatestPluginCache
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| alternative_plugin_id | string | | Yes |
|
|
| deprecated_reason | string | | Yes |
|
|
| plugin_id | string | | Yes |
|
|
| status | string, <br>**Available values:** "active", "deleted" | *Enum:* `"active"`, `"deleted"` | Yes |
|
|
| unique_identifier | string | | Yes |
|
|
| version | string | | Yes |
|
|
|
|
#### LearnDifyAppListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| recommended_apps | [ [RecommendedAppResponse](#recommendedappresponse) ] | | Yes |
|
|
|
|
#### LegacyEndpointUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| endpoint_id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| settings | object | | Yes |
|
|
|
|
#### LicenseLimitationModel
|
|
|
|
- enabled: whether this limit is enforced
|
|
- size: current usage count
|
|
- limit: maximum allowed count; 0 means unlimited
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | Whether this limit is currently active | Yes |
|
|
| limit | integer | Maximum number of resources allowed; 0 means no limit | Yes |
|
|
| size | integer | Number of resources already consumed | Yes |
|
|
|
|
#### LicenseModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| expired_at | string | | Yes |
|
|
| seats | [LicenseLimitationModel](#licenselimitationmodel) | | Yes |
|
|
| status | [LicenseStatus](#licensestatus) | | Yes |
|
|
| workspaces | [LicenseLimitationModel](#licenselimitationmodel) | | Yes |
|
|
|
|
#### LicenseStatus
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| LicenseStatus | string | | |
|
|
|
|
#### LicenseStatusModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| status | [LicenseStatus](#licensestatus) | | Yes |
|
|
|
|
#### LimitationModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| limit | integer | | Yes |
|
|
| size | integer | | Yes |
|
|
|
|
#### LoadBalancingCredentialPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | object | | Yes |
|
|
| model | string | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
|
|
#### LoadBalancingCredentialValidateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| error | string | | No |
|
|
| result | string | | Yes |
|
|
|
|
#### LoadBalancingPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| configs | [ object ] | | No |
|
|
| enabled | boolean | | No |
|
|
|
|
#### LoginPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | Yes |
|
|
| invite_token | string | Invitation token | No |
|
|
| password | string | | Yes |
|
|
| remember_me | boolean | Remember me flag | No |
|
|
|
|
#### LoopNodeRunPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| inputs | object | | No |
|
|
|
|
#### MCPAuthPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| authorization_code | string | | No |
|
|
| provider_id | string | | Yes |
|
|
|
|
#### MCPAuthResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| authorization_url | string | | No |
|
|
| result | string | | No |
|
|
|
|
#### MCPAuthentication
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| client_id | string | | Yes |
|
|
| client_secret | string | | No |
|
|
|
|
#### MCPCallbackQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | | Yes |
|
|
| state | string | | Yes |
|
|
|
|
#### MCPConfiguration
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| sse_read_timeout | number, <br>**Default:** 300 | | No |
|
|
| timeout | number, <br>**Default:** 30 | | No |
|
|
|
|
#### MCPProviderCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| authentication | [MCPAuthentication](#mcpauthentication) | | No |
|
|
| configuration | [MCPConfiguration](#mcpconfiguration) | | No |
|
|
| headers | object | | No |
|
|
| icon | string | | Yes |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | Yes |
|
|
| identity_mode | [IdentityMode](#identitymode) | | No |
|
|
| name | string | | Yes |
|
|
| server_identifier | string | | Yes |
|
|
| server_url | string | | Yes |
|
|
|
|
#### MCPProviderDeletePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| provider_id | string | | Yes |
|
|
|
|
#### MCPProviderUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| authentication | [MCPAuthentication](#mcpauthentication) | | No |
|
|
| configuration | [MCPConfiguration](#mcpconfiguration) | | No |
|
|
| headers | object | | No |
|
|
| icon | string | | Yes |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | Yes |
|
|
| identity_mode | [IdentityMode](#identitymode) | | No |
|
|
| name | string | | Yes |
|
|
| provider_id | string | | Yes |
|
|
| server_identifier | string | | Yes |
|
|
| server_url | string | | Yes |
|
|
|
|
#### MCPServerCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | Server description | No |
|
|
| parameters | object | Server parameters configuration | Yes |
|
|
|
|
#### MCPServerUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | Server description | No |
|
|
| id | string | Server ID | Yes |
|
|
| parameters | object | Server parameters configuration | Yes |
|
|
| status | string | Server status | No |
|
|
|
|
#### Marketplace
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| marketplace_plugin_unique_identifier | string | | Yes |
|
|
| version | string | | No |
|
|
|
|
#### MemberActionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | | Yes |
|
|
| tenant_id | string | | Yes |
|
|
|
|
#### MemberBindingsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AccessPolicyMemberBinding](#accesspolicymemberbinding) ] | | No |
|
|
|
|
#### MemberInviteAlreadyMemberResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | Yes |
|
|
| message | string | | Yes |
|
|
| status | string | | Yes |
|
|
|
|
#### MemberInviteErrorResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string, <br>**Available values:** "invalid_param", "invalid_role", "limit_exceeded" | *Enum:* `"invalid_param"`, `"invalid_role"`, `"limit_exceeded"` | Yes |
|
|
| message | string | | Yes |
|
|
| status | integer | | Yes |
|
|
|
|
#### MemberInviteFailedResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | Yes |
|
|
| message | string | | Yes |
|
|
| status | string | | Yes |
|
|
|
|
#### MemberInvitePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| emails | [ string ] | | Yes |
|
|
| language | string | | No |
|
|
| role | string | | Yes |
|
|
|
|
#### MemberInviteResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| invitation_results | [ [MemberInviteSuccessResponse](#memberinvitesuccessresponse)<br>[MemberInviteAlreadyMemberResponse](#memberinvitealreadymemberresponse)<br>[MemberInviteFailedResponse](#memberinvitefailedresponse) ] | | Yes |
|
|
| result | string | | Yes |
|
|
| tenant_id | string | | Yes |
|
|
|
|
#### MemberInviteSuccessResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | Yes |
|
|
| status | string | | Yes |
|
|
| url | string | | Yes |
|
|
|
|
#### MemberRoleUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| role | string | | Yes |
|
|
|
|
#### MemberRolesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| account_id | string | | Yes |
|
|
| roles | [ [RBACRole](#rbacrole) ] | | No |
|
|
|
|
#### MembersInRole
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| account_id | string | | No |
|
|
| account_name | string | | No |
|
|
|
|
#### MessageDetail
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_thoughts | [ [AgentThought](#agentthought) ] | | Yes |
|
|
| annotation | [ConversationAnnotation](#conversationannotation) | | No |
|
|
| annotation_hit_history | [ConversationAnnotationHitHistory](#conversationannotationhithistory) | | No |
|
|
| answer | string | | Yes |
|
|
| answer_tokens | integer | | Yes |
|
|
| conversation_id | string | | Yes |
|
|
| created_at | integer | | No |
|
|
| error | string | | No |
|
|
| feedbacks | [ [Feedback](#feedback) ] | | Yes |
|
|
| from_account_id | string | | No |
|
|
| from_end_user_id | string | | No |
|
|
| from_source | string | | Yes |
|
|
| id | string | | Yes |
|
|
| inputs | object | | Yes |
|
|
| message | [JSONValue](#jsonvalue) | | Yes |
|
|
| message_files | [ [MessageFile](#messagefile) ] | | Yes |
|
|
| message_tokens | integer | | Yes |
|
|
| metadata | [JSONValue](#jsonvalue) | | Yes |
|
|
| parent_message_id | string | | No |
|
|
| provider_response_latency | number | | Yes |
|
|
| query | string | | Yes |
|
|
| status | string | | Yes |
|
|
| workflow_run_id | string | | No |
|
|
|
|
#### MessageDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_thoughts | [ [AgentThought](#agentthought) ] | | Yes |
|
|
| annotation | [ConversationAnnotation](#conversationannotation) | | No |
|
|
| annotation_hit_history | [ConversationAnnotationHitHistory](#conversationannotationhithistory) | | No |
|
|
| answer | string | | Yes |
|
|
| answer_tokens | integer | | Yes |
|
|
| conversation_id | string | | Yes |
|
|
| created_at | integer | | No |
|
|
| error | string | | No |
|
|
| extra_contents | [ [HumanInputContent](#humaninputcontent) ] | | No |
|
|
| feedbacks | [ [Feedback](#feedback) ] | | Yes |
|
|
| from_account_id | string | | No |
|
|
| from_end_user_id | string | | No |
|
|
| from_source | string | | Yes |
|
|
| id | string | | Yes |
|
|
| inputs | object | | Yes |
|
|
| message | [JSONValue](#jsonvalue) | | Yes |
|
|
| message_files | [ [MessageFile](#messagefile) ] | | Yes |
|
|
| message_tokens | integer | | Yes |
|
|
| metadata | [JSONValue](#jsonvalue) | | Yes |
|
|
| parent_message_id | string | | No |
|
|
| provider_response_latency | number | | Yes |
|
|
| query | string | | Yes |
|
|
| status | string | | Yes |
|
|
| workflow_run_id | string | | No |
|
|
|
|
#### MessageFeedbackPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | Optional text feedback providing additional detail. | No |
|
|
| message_id | string | Message ID | Yes |
|
|
| rating | string | Feedback rating. Set to `null` to revoke previously submitted feedback. | No |
|
|
|
|
#### MessageFile
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| belongs_to | string | | No |
|
|
| filename | string | | Yes |
|
|
| id | string | | Yes |
|
|
| mime_type | string | | No |
|
|
| size | integer | | No |
|
|
| transfer_method | string | | Yes |
|
|
| type | string | | Yes |
|
|
| upload_file_id | string | | No |
|
|
| url | string | | No |
|
|
|
|
#### MessageInfiniteScrollPaginationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [MessageDetailResponse](#messagedetailresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
|
|
#### MessageListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_id | string | Conversation ID. | Yes |
|
|
| first_id | string | The ID of the first chat record on the current page. Omit this value to fetch the latest messages; for subsequent pages, use the first message ID from the current list to fetch older messages. | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of chat history messages to return per request. | No |
|
|
|
|
#### Meta
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| minimum_dify_version | string | | No |
|
|
| version | string | | No |
|
|
|
|
#### MetadataArgs
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | Metadata field name. | Yes |
|
|
| type | string, <br>**Available values:** "number", "string", "time" | `string` for text values, `number` for numeric values, `time` for date/time values.<br>*Enum:* `"number"`, `"string"`, `"time"` | Yes |
|
|
|
|
#### MetadataDetail
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | Metadata field ID. | Yes |
|
|
| name | string | Metadata field name. | Yes |
|
|
| value | string<br>integer<br>number | Metadata value. Can be a string, number, or `null`. | No |
|
|
|
|
#### MetadataFilteringCondition
|
|
|
|
Metadata Filtering Condition.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conditions | [ [Condition](#condition) ] | List of metadata conditions to evaluate. | No |
|
|
| logical_operator | string | How to combine multiple conditions. | No |
|
|
|
|
#### MetadataOperationData
|
|
|
|
Metadata operation data
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| operation_data | [ [DocumentMetadataOperation](#documentmetadataoperation) ] | Array of document metadata update operations. Each entry maps a document ID to its metadata values. | Yes |
|
|
|
|
#### MetadataUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | New metadata field name. | Yes |
|
|
|
|
#### Model
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | No |
|
|
| llm | boolean | | No |
|
|
| moderation | boolean | | No |
|
|
| rerank | boolean | | No |
|
|
| speech2text | boolean | | No |
|
|
| text_embedding | boolean | | No |
|
|
| tts | boolean | | No |
|
|
|
|
#### ModelConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| completion_params | object | | No |
|
|
| mode | [LLMMode](#llmmode) | | Yes |
|
|
| name | string | | Yes |
|
|
| provider | string | | Yes |
|
|
|
|
#### ModelConfigPartial
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| model | | | No |
|
|
| pre_prompt | string | | No |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
|
|
#### ModelConfigRequest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_mode | object | Agent mode configuration | No |
|
|
| configs | object | Model configuration parameters | No |
|
|
| dataset_configs | object | Dataset configurations | No |
|
|
| model | string | Model name | No |
|
|
| more_like_this | object | More like this configuration | No |
|
|
| opening_statement | string | Opening statement | No |
|
|
| provider | string | Model provider | No |
|
|
| retrieval_model | object | Retrieval model configuration | No |
|
|
| speech_to_text | object | Speech to text configuration | No |
|
|
| suggested_questions | [ string ] | Suggested questions | No |
|
|
| text_to_speech | object | Text to speech configuration | No |
|
|
| tools | [ object ] | Available tools | No |
|
|
|
|
#### ModelCredentialResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| available_credentials | [ [CredentialConfiguration](#credentialconfiguration) ] | | Yes |
|
|
| credentials | object | | Yes |
|
|
| current_credential_id | string | | No |
|
|
| current_credential_name | string | | No |
|
|
| load_balancing | [ModelLoadBalancingResponse](#modelloadbalancingresponse) | | Yes |
|
|
|
|
#### ModelCredentialSchema
|
|
|
|
Model class for model credential schema.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_form_schemas | [ [CredentialFormSchema](#credentialformschema) ] | | Yes |
|
|
| model | [FieldModelSchema](#fieldmodelschema) | | Yes |
|
|
|
|
#### ModelFeature
|
|
|
|
Enum class for llm feature.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ModelFeature | string | Enum class for llm feature. | |
|
|
|
|
#### ModelLoadBalancingConfigResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | No |
|
|
| credentials | object | | Yes |
|
|
| enabled | boolean | | Yes |
|
|
| id | string | | Yes |
|
|
| in_cooldown | boolean | | Yes |
|
|
| name | string | | Yes |
|
|
| ttl | integer | | Yes |
|
|
|
|
#### ModelLoadBalancingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| configs | [ [ModelLoadBalancingConfigResponse](#modelloadbalancingconfigresponse) ] | | Yes |
|
|
| enabled | boolean | | Yes |
|
|
|
|
#### ModelParameterRuleListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ParameterRule](#parameterrule) ] | | Yes |
|
|
|
|
#### ModelPropertyKey
|
|
|
|
Enum class for model property key.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ModelPropertyKey | string | Enum class for model property key. | |
|
|
|
|
#### ModelProviderListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ProviderResponse](#providerresponse) ] | | Yes |
|
|
|
|
#### ModelProviderPaymentCheckoutUrlResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| payment_link | string | | Yes |
|
|
|
|
#### ModelSelectorScope
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ModelSelectorScope | string | | |
|
|
|
|
#### ModelStatus
|
|
|
|
Enum class for model status.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ModelStatus | string | Enum class for model status. | |
|
|
|
|
#### ModelType
|
|
|
|
Enum class for model type.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ModelType | string | Enum class for model type. | |
|
|
|
|
#### ModelWithProviderEntityResponse
|
|
|
|
Model with provider entity.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| deprecated | boolean | | No |
|
|
| features | [ [ModelFeature](#modelfeature) ] | | No |
|
|
| fetch_from | [FetchFrom](#fetchfrom) | | Yes |
|
|
| has_invalid_load_balancing_configs | boolean | | No |
|
|
| label | [I18nObject](#i18nobject) | | Yes |
|
|
| load_balancing_enabled | boolean | | No |
|
|
| model | string | | Yes |
|
|
| model_properties | object | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
| provider | [SimpleProviderEntityResponse](#simpleproviderentityresponse) | | Yes |
|
|
| status | [ModelStatus](#modelstatus) | | Yes |
|
|
|
|
#### MoreLikeThisQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| response_mode | string, <br>**Available values:** "blocking", "streaming" | *Enum:* `"blocking"`, `"streaming"` | Yes |
|
|
|
|
#### MyPermissionsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app | [ResourcePermissionSnapshot](#resourcepermissionsnapshot) | | No |
|
|
| dataset | [ResourcePermissionSnapshot](#resourcepermissionsnapshot) | | No |
|
|
| workspace | [WorkspacePermissionSnapshot](#workspacepermissionsnapshot) | | No |
|
|
|
|
#### NewAppResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| new_app_id | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
|
|
#### Node
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | No |
|
|
|
|
#### NodeIdQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| node_id | string | | Yes |
|
|
|
|
#### NodeOutputStatus
|
|
|
|
Lifecycle status of a single declared output within a run.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| NodeOutputStatus | string | Lifecycle status of a single declared output within a run. | |
|
|
|
|
#### NodeOutputView
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | | Yes |
|
|
| output_check | [CheckResultView](#checkresultview) | | No |
|
|
| retried | integer | | No |
|
|
| status | [NodeOutputStatus](#nodeoutputstatus) | | Yes |
|
|
| type | [DeclaredOutputType](#declaredoutputtype) | | No |
|
|
| type_check | [CheckResultView](#checkresultview) | | No |
|
|
| value_preview | | | No |
|
|
|
|
#### NodeOutputsView
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| node_completed_at | string | | No |
|
|
| node_display_name | string | | Yes |
|
|
| node_id | string | | Yes |
|
|
| node_kind | string | | Yes |
|
|
| node_started_at | string | | No |
|
|
| node_status | [NodeStatus](#nodestatus) | | Yes |
|
|
| outputs | [ [NodeOutputView](#nodeoutputview) ] | | No |
|
|
|
|
#### NodeRunPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| inputs | object | | No |
|
|
|
|
#### NodeRunRequiredPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| inputs | object | | Yes |
|
|
|
|
#### NodeStatus
|
|
|
|
Coarse node-level status used by Inspector to pick a banner.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| NodeStatus | string | Coarse node-level status used by Inspector to pick a banner. | |
|
|
|
|
#### NotificationItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| body | string | | Yes |
|
|
| frequency | string | | No |
|
|
| lang | string | | Yes |
|
|
| notification_id | string | | No |
|
|
| subtitle | string | | Yes |
|
|
| title | string | | Yes |
|
|
| title_pic_url | string | | Yes |
|
|
|
|
#### NotificationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| notifications | [ [NotificationItemResponse](#notificationitemresponse) ] | | Yes |
|
|
| should_show | boolean | | Yes |
|
|
|
|
#### NotionEstimatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| doc_form | string, <br>**Default:** text_model | | No |
|
|
| doc_language | string, <br>**Default:** English | | No |
|
|
| notion_info_list | [ object ] | | Yes |
|
|
| process_rule | object | | Yes |
|
|
|
|
#### NotionIcon
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| emoji | string | | No |
|
|
| type | string | | Yes |
|
|
| url | string | | No |
|
|
|
|
#### NotionInfo
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | Yes |
|
|
| pages | [ [NotionPage](#notionpage) ] | | Yes |
|
|
| workspace_id | string | | Yes |
|
|
|
|
#### NotionIntegrateInfoListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| notion_info | [ [NotionIntegrateWorkspaceResponse](#notionintegrateworkspaceresponse) ] | | Yes |
|
|
|
|
#### NotionIntegratePageResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| is_bound | boolean | | Yes |
|
|
| page_icon | [DataSourceIntegrateIconResponse](#datasourceintegrateiconresponse) | | Yes |
|
|
| page_id | string | | Yes |
|
|
| page_name | string | | Yes |
|
|
| parent_id | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### NotionIntegrateWorkspaceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| pages | [ [NotionIntegratePageResponse](#notionintegratepageresponse) ] | | Yes |
|
|
| workspace_icon | string | | Yes |
|
|
| workspace_id | string | | Yes |
|
|
| workspace_name | string | | Yes |
|
|
|
|
#### NotionPage
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| page_icon | [NotionIcon](#notionicon) | | No |
|
|
| page_id | string | | Yes |
|
|
| page_name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### OAuthCallbackQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | Authorization code from OAuth provider | Yes |
|
|
| state | string | OAuth state parameter | No |
|
|
|
|
#### OAuthClientPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| client_id | string | | Yes |
|
|
|
|
#### OAuthDataSourceBindingQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | Authorization code from OAuth provider | Yes |
|
|
|
|
#### OAuthDataSourceBindingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | Operation result | Yes |
|
|
|
|
#### OAuthDataSourceCallbackQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | Authorization code from OAuth provider | No |
|
|
| error | string | Error message from OAuth provider | No |
|
|
|
|
#### OAuthDataSourceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | string | Authorization URL or 'internal' for internal setup | Yes |
|
|
|
|
#### OAuthDataSourceSyncResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | Operation result | Yes |
|
|
|
|
#### OAuthLoginQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| invite_token | string | Optional invitation token | No |
|
|
| language | string | Preferred interface language | No |
|
|
| redirect_url | string | Relative page to resume after login | No |
|
|
| timezone | string | Preferred timezone | No |
|
|
|
|
#### OAuthProviderAccountResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| avatar | string | | No |
|
|
| email | string | | Yes |
|
|
| interface_language | string | | Yes |
|
|
| name | string | | Yes |
|
|
| timezone | string | | Yes |
|
|
|
|
#### OAuthProviderAppResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_icon | string | | Yes |
|
|
| app_label | object | | Yes |
|
|
| scope | string | | Yes |
|
|
|
|
#### OAuthProviderAuthorizeResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | | Yes |
|
|
|
|
#### OAuthProviderRequest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| client_id | string | | Yes |
|
|
| redirect_uri | string | | Yes |
|
|
|
|
#### OAuthProviderTokenResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_token | string | | Yes |
|
|
| expires_in | integer | | Yes |
|
|
| refresh_token | string | | Yes |
|
|
| token_type | string | | Yes |
|
|
|
|
#### OAuthSchema
|
|
|
|
OAuth schema
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| client_schema | [ [ProviderConfig](#providerconfig) ] | client schema like client_id, client_secret, etc. | No |
|
|
| credentials_schema | [ [ProviderConfig](#providerconfig) ] | credentials schema like access_token, refresh_token, etc. | No |
|
|
|
|
#### OAuthTokenRequest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| client_id | string | | Yes |
|
|
| client_secret | string | | No |
|
|
| code | string | | No |
|
|
| grant_type | string | | Yes |
|
|
| redirect_uri | string | | No |
|
|
| refresh_token | string | | No |
|
|
|
|
#### Option
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| label | [I18nObject](#i18nobject) | The label of the option | Yes |
|
|
| value | string | The value of the option | Yes |
|
|
|
|
#### OutputErrorStrategy
|
|
|
|
Per-output failure handling strategy.
|
|
|
|
Mirrors ``graphon.ErrorStrategy`` but scoped to a single declared output of
|
|
a Workflow Agent Node. The runtime applies the strategy after type check or
|
|
output check fails and any configured retry attempts have been exhausted.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| OutputErrorStrategy | string | Per-output failure handling strategy. Mirrors ``graphon.ErrorStrategy`` but scoped to a single declared output of a Workflow Agent Node. The runtime applies the strategy after type check or output check fails and any configured retry attempts have been exhausted. | |
|
|
|
|
#### OutputPreviewView
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| node_id | string | | Yes |
|
|
| output_name | string | | Yes |
|
|
| status | [NodeOutputStatus](#nodeoutputstatus) | | Yes |
|
|
| type | [DeclaredOutputType](#declaredoutputtype) | | No |
|
|
| value | | | No |
|
|
|
|
#### OwnerTransferCheckPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | string | | Yes |
|
|
| token | string | | Yes |
|
|
|
|
#### OwnerTransferEmailPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| language | string | | No |
|
|
|
|
#### OwnerTransferPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| token | string | | Yes |
|
|
|
|
#### Package
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| plugin_unique_identifier | string | | Yes |
|
|
| version | string | | No |
|
|
|
|
#### PaginatedConversationVariableResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ConversationVariableResponse](#conversationvariableresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### Pagination
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| current_page | integer | | No |
|
|
| per_page | integer | | No |
|
|
| total_count | integer | | No |
|
|
| total_pages | integer | | No |
|
|
|
|
#### PaginationQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| limit | integer, <br>**Default:** 20 | | No |
|
|
| page | integer, <br>**Default:** 1 | | No |
|
|
|
|
#### ParagraphInputConfig
|
|
|
|
Form input definition.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| default | [StringSource](#stringsource) | | No |
|
|
| output_variable_name | string | | Yes |
|
|
| type | string | | No |
|
|
|
|
#### ParameterRule
|
|
|
|
Model class for parameter rule.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| default | | | No |
|
|
| help | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | No |
|
|
| label | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | Yes |
|
|
| max | number | | No |
|
|
| min | number | | No |
|
|
| name | string | | Yes |
|
|
| options | [ string ], <br>**Default:** | | No |
|
|
| precision | integer | | No |
|
|
| required | boolean | | No |
|
|
| type | [ParameterType](#parametertype) | | Yes |
|
|
| use_template | string | | No |
|
|
|
|
#### ParameterType
|
|
|
|
Enum class for parameter type.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ParameterType | string | Enum class for parameter type. | |
|
|
|
|
#### Parameters
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| annotation_reply | [JSONObject](#jsonobject) | | Yes |
|
|
| file_upload | [JSONObject](#jsonobject) | | Yes |
|
|
| more_like_this | [JSONObject](#jsonobject) | | Yes |
|
|
| opening_statement | | | No |
|
|
| retriever_resource | [JSONObject](#jsonobject) | | Yes |
|
|
| sensitive_word_avoidance | [JSONObject](#jsonobject) | | Yes |
|
|
| speech_to_text | [JSONObject](#jsonobject) | | Yes |
|
|
| suggested_questions | [ string ] | | Yes |
|
|
| suggested_questions_after_answer | [JSONObject](#jsonobject) | | Yes |
|
|
| system_parameters | [SystemParameters](#systemparameters) | | Yes |
|
|
| text_to_speech | [JSONObject](#jsonobject) | | Yes |
|
|
| user_input_form | [ [JSONObject](#jsonobject) ] | | Yes |
|
|
|
|
#### Parser
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | No |
|
|
| datasource_type | string | | Yes |
|
|
| inputs | object | | Yes |
|
|
|
|
#### ParserAsset
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| file_name | string | | Yes |
|
|
| plugin_unique_identifier | string | | Yes |
|
|
|
|
#### ParserAutoUpgradeChange
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| auto_upgrade | [PluginAutoUpgradeSettingsPayload](#pluginautoupgradesettingspayload) | | Yes |
|
|
| category | [TenantPluginAutoUpgradeCategory](#tenantpluginautoupgradecategory) | | Yes |
|
|
|
|
#### ParserAutoUpgradeFetch
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| category | [TenantPluginAutoUpgradeCategory](#tenantpluginautoupgradecategory) | | Yes |
|
|
|
|
#### ParserCreateCredential
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | object | | Yes |
|
|
| model | string | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
| name | string | | No |
|
|
|
|
#### ParserCredentialCreate
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | object | | Yes |
|
|
| name | string | | No |
|
|
|
|
#### ParserCredentialDelete
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | Yes |
|
|
|
|
#### ParserCredentialId
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | No |
|
|
|
|
#### ParserCredentialSwitch
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | Yes |
|
|
|
|
#### ParserCredentialUpdate
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | Yes |
|
|
| credentials | object | | Yes |
|
|
| name | string | | No |
|
|
|
|
#### ParserCredentialValidate
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | object | | Yes |
|
|
|
|
#### ParserDeleteCredential
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | Yes |
|
|
| model | string | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
|
|
#### ParserDeleteModels
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| model | string | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
|
|
#### ParserDynamicOptions
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| action | string | | Yes |
|
|
| credential_id | string | | No |
|
|
| parameter | string | | Yes |
|
|
| plugin_id | string | | Yes |
|
|
| provider | string | | Yes |
|
|
| provider_type | string, <br>**Available values:** "tool", "trigger" | *Enum:* `"tool"`, `"trigger"` | Yes |
|
|
|
|
#### ParserDynamicOptionsWithCredentials
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| action | string | | Yes |
|
|
| credential_id | string | | Yes |
|
|
| credentials | object | | Yes |
|
|
| parameter | string | | Yes |
|
|
| plugin_id | string | | Yes |
|
|
| provider | string | | Yes |
|
|
|
|
#### ParserEnable
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enable_trigger | boolean | | Yes |
|
|
| trigger_id | string | | Yes |
|
|
|
|
#### ParserExcludePlugin
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| category | [TenantPluginAutoUpgradeCategory](#tenantpluginautoupgradecategory) | | Yes |
|
|
| plugin_id | string | | Yes |
|
|
|
|
#### ParserGetCredentials
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| config_from | string | | No |
|
|
| credential_id | string | | No |
|
|
| model | string | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
|
|
#### ParserGetDefault
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
|
|
#### ParserGithubInstall
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| package | string | | Yes |
|
|
| plugin_unique_identifier | string | | Yes |
|
|
| repo | string | | Yes |
|
|
| version | string | | Yes |
|
|
|
|
#### ParserGithubUpgrade
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| new_plugin_unique_identifier | string | | Yes |
|
|
| original_plugin_unique_identifier | string | | Yes |
|
|
| package | string | | Yes |
|
|
| repo | string | | Yes |
|
|
| version | string | | Yes |
|
|
|
|
#### ParserGithubUpload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| package | string | | Yes |
|
|
| repo | string | | Yes |
|
|
| version | string | | Yes |
|
|
|
|
#### ParserIcon
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| filename | string | | Yes |
|
|
| tenant_id | string | | Yes |
|
|
|
|
#### ParserLatest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| plugin_ids | [ string ] | | Yes |
|
|
|
|
#### ParserList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| page | integer, <br>**Default:** 1 | Page number | No |
|
|
| page_size | integer, <br>**Default:** 256 | Page size (1-256) | No |
|
|
|
|
#### ParserMarketplaceUpgrade
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| new_plugin_unique_identifier | string | | Yes |
|
|
| original_plugin_unique_identifier | string | | Yes |
|
|
|
|
#### ParserModelList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| model_type | [ModelType](#modeltype) | | No |
|
|
|
|
#### ParserParameter
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| model | string | | Yes |
|
|
|
|
#### ParserPermissionChange
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| debug_permission | [TenantPluginDebugPermission](#tenantplugindebugpermission) | | No |
|
|
| install_permission | [TenantPluginInstallPermission](#tenantplugininstallpermission) | | No |
|
|
|
|
#### ParserPluginIdentifierQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| plugin_unique_identifier | string | | Yes |
|
|
|
|
#### ParserPluginIdentifiers
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| plugin_unique_identifiers | [ string ] | | Yes |
|
|
|
|
#### ParserPostDefault
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| model_settings | [ [Inner](#inner) ] | | Yes |
|
|
|
|
#### ParserPostModels
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| config_from | string | | No |
|
|
| credential_id | string | | No |
|
|
| load_balancing | [LoadBalancingPayload](#loadbalancingpayload) | | No |
|
|
| model | string | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
|
|
#### ParserPreferredProviderType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| preferred_provider_type | string, <br>**Available values:** "custom", "system" | *Enum:* `"custom"`, `"system"` | Yes |
|
|
|
|
#### ParserReadme
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| language | string, <br>**Default:** en-US | | No |
|
|
| plugin_unique_identifier | string | | Yes |
|
|
|
|
#### ParserSwitch
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | Yes |
|
|
| model | string | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
|
|
#### ParserTasks
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| page | integer, <br>**Default:** 1 | Page number | No |
|
|
| page_size | integer, <br>**Default:** 256 | Page size (1-256) | No |
|
|
|
|
#### ParserUninstall
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| plugin_installation_id | string | | Yes |
|
|
|
|
#### ParserUpdateCredential
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_id | string | | Yes |
|
|
| credentials | object | | Yes |
|
|
| model | string | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
| name | string | | No |
|
|
|
|
#### ParserValidate
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | object | | Yes |
|
|
| model | string | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
|
|
#### PartialMemberListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ string ] | | Yes |
|
|
|
|
#### PartnerTenantsPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| click_id | string | Click Id from partner referral link | Yes |
|
|
|
|
#### PausedNodeResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| node_id | string | | Yes |
|
|
| node_title | string | | Yes |
|
|
| pause_type | [HumanInputPauseTypeResponse](#humaninputpausetyperesponse) | | Yes |
|
|
|
|
#### Permission
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| endpoint | [Endpoint](#endpoint) | | No |
|
|
| model | [Model](#model) | | No |
|
|
| node | [Node](#node) | | No |
|
|
| storage | [Storage](#storage) | | No |
|
|
| tool | [Tool](#tool) | | No |
|
|
|
|
#### PermissionCatalogGroup
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| group_key | string | | Yes |
|
|
| group_name | string | | Yes |
|
|
| permissions | [ [PermissionCatalogItem](#permissioncatalogitem) ] | | No |
|
|
|
|
#### PermissionCatalogItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| key | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### PermissionCatalogResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| groups | [ [PermissionCatalogGroup](#permissioncataloggroup) ] | | No |
|
|
|
|
#### PermissionEnum
|
|
|
|
Shared permission levels for resources (datasets, credentials, etc.)
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| PermissionEnum | string | Shared permission levels for resources (datasets, credentials, etc.) | |
|
|
|
|
#### PipelineTemplateDetailQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| type | string, <br>**Default:** built-in | Template source: built-in or customized | No |
|
|
|
|
#### PipelineTemplateDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| chunk_structure | string | | Yes |
|
|
| created_by | string | | No |
|
|
| description | string | | Yes |
|
|
| export_data | string | | Yes |
|
|
| graph | object | | Yes |
|
|
| icon_info | object | | Yes |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### PipelineTemplateItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| chunk_structure | string | | Yes |
|
|
| copyright | string | | No |
|
|
| description | string | | Yes |
|
|
| icon | object | | Yes |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| position | integer | | Yes |
|
|
| privacy_policy | string | | No |
|
|
|
|
#### PipelineTemplateListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| language | string, <br>**Default:** en-US | Template language | No |
|
|
| type | string, <br>**Default:** built-in | Template source: built-in or customized | No |
|
|
|
|
#### PipelineTemplateListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| pipeline_templates | [ [PipelineTemplateItemResponse](#pipelinetemplateitemresponse) ] | | Yes |
|
|
|
|
#### PipelineVariableResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allowed_file_extensions | [ string ] | | No |
|
|
| allowed_file_types | [ string ] | | No |
|
|
| allowed_file_upload_methods | [ string ] | | No |
|
|
| belong_to_node_id | string | | Yes |
|
|
| default_value | | | No |
|
|
| label | string | | Yes |
|
|
| max_length | integer | | No |
|
|
| options | [ string ] | | No |
|
|
| placeholder | string | | No |
|
|
| required | boolean | | Yes |
|
|
| tooltips | string | | No |
|
|
| type | string | | Yes |
|
|
| unit | string | | No |
|
|
| variable | string | | Yes |
|
|
|
|
#### PluginAutoUpgradeChangeResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| message | string | | No |
|
|
| success | boolean | | Yes |
|
|
|
|
#### PluginAutoUpgradeFetchResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| auto_upgrade | [PluginAutoUpgradeSettingsResponseModel](#pluginautoupgradesettingsresponsemodel) | | Yes |
|
|
| category | [TenantPluginAutoUpgradeCategory](#tenantpluginautoupgradecategory) | | Yes |
|
|
|
|
#### PluginAutoUpgradeSettingsPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| exclude_plugins | [ string ] | | No |
|
|
| include_plugins | [ string ] | | No |
|
|
| strategy_setting | [TenantPluginAutoUpgradeStrategySetting](#tenantpluginautoupgradestrategysetting) | | No |
|
|
| upgrade_mode | [TenantPluginAutoUpgradeMode](#tenantpluginautoupgrademode) | | No |
|
|
| upgrade_time_of_day | integer | | No |
|
|
|
|
#### PluginAutoUpgradeSettingsResponseModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| exclude_plugins | [ string ] | | Yes |
|
|
| include_plugins | [ string ] | | Yes |
|
|
| strategy_setting | [TenantPluginAutoUpgradeStrategySetting](#tenantpluginautoupgradestrategysetting) | | Yes |
|
|
| upgrade_mode | [TenantPluginAutoUpgradeMode](#tenantpluginautoupgrademode) | | Yes |
|
|
| upgrade_time_of_day | integer | | Yes |
|
|
|
|
#### PluginBundleDependency
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| type | [PluginBundleDependencyType](#pluginbundledependencytype) | | Yes |
|
|
| value | [Github](#github)<br>[Marketplace](#marketplace)<br>[Package](#package) | | Yes |
|
|
|
|
#### PluginBundleDependencyType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| PluginBundleDependencyType | string | | |
|
|
|
|
#### PluginBundleUploadResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| PluginBundleUploadResponse | array | | |
|
|
|
|
#### PluginCategory
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| PluginCategory | string | | |
|
|
|
|
#### PluginCategoryBuiltinToolProviderResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allow_delete | boolean | | Yes |
|
|
| author | string | | Yes |
|
|
| description | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | | Yes |
|
|
| icon | string<br>object | | Yes |
|
|
| icon_dark | string<br>object | | Yes |
|
|
| id | string | | Yes |
|
|
| is_team_authorization | boolean | | Yes |
|
|
| label | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | | Yes |
|
|
| labels | [ string ] | | Yes |
|
|
| name | string | | Yes |
|
|
| plugin_id | string | | Yes |
|
|
| plugin_unique_identifier | string | | Yes |
|
|
| team_credentials | object | | Yes |
|
|
| tools | [ [PluginCategoryBuiltinToolResponse](#plugincategorybuiltintoolresponse) ] | | Yes |
|
|
| type | [ToolProviderType](#toolprovidertype) | | Yes |
|
|
|
|
#### PluginCategoryBuiltinToolResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| author | string | | Yes |
|
|
| description | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | | Yes |
|
|
| label | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | | Yes |
|
|
| labels | [ string ] | | Yes |
|
|
| name | string | | Yes |
|
|
| output_schema | object | | Yes |
|
|
| parameters | [ object ] | | No |
|
|
|
|
#### PluginCategoryInstalledPluginResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| checksum | string | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| declaration | [PluginDeclarationResponse](#plugindeclarationresponse) | | Yes |
|
|
| endpoints_active | integer | | Yes |
|
|
| endpoints_setups | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| installation_id | string | | Yes |
|
|
| meta | object | | Yes |
|
|
| name | string | | Yes |
|
|
| plugin_id | string | | Yes |
|
|
| plugin_unique_identifier | string | | Yes |
|
|
| runtime_type | string | | Yes |
|
|
| source | [PluginInstallationSource](#plugininstallationsource) | | Yes |
|
|
| tenant_id | string | | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
| version | string | | Yes |
|
|
|
|
#### PluginCategoryListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| page | integer, <br>**Default:** 1 | Page number | No |
|
|
| page_size | integer, <br>**Default:** 256 | Page size (1-256) | No |
|
|
|
|
#### PluginCategoryListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| builtin_tools | [ [PluginCategoryBuiltinToolProviderResponse](#plugincategorybuiltintoolproviderresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| plugins | [ [PluginCategoryInstalledPluginResponse](#plugincategoryinstalledpluginresponse) ] | | Yes |
|
|
|
|
#### PluginDebuggingKeyResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| host | string | | Yes |
|
|
| key | string | | Yes |
|
|
| port | integer | | Yes |
|
|
|
|
#### PluginDeclaration
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_strategy | [AgentStrategyProviderEntity](#agentstrategyproviderentity) | | No |
|
|
| author | string | | Yes |
|
|
| category | [PluginCategory](#plugincategory) | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| datasource | [DatasourceProviderEntity](#datasourceproviderentity) | | No |
|
|
| description | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | | Yes |
|
|
| endpoint | [EndpointProviderDeclaration](#endpointproviderdeclaration) | | No |
|
|
| icon | string | | Yes |
|
|
| icon_dark | string | | No |
|
|
| label | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | | Yes |
|
|
| meta | [Meta](#meta) | | Yes |
|
|
| model | [ProviderEntity](#providerentity) | | No |
|
|
| name | string | | Yes |
|
|
| plugins | [Plugins](#plugins) | | Yes |
|
|
| repo | string | | No |
|
|
| resource | [PluginResourceRequirements](#pluginresourcerequirements) | | Yes |
|
|
| tags | [ string ] | | No |
|
|
| tool | [ToolProviderEntity](#toolproviderentity) | | No |
|
|
| trigger | [TriggerProviderEntity](#triggerproviderentity) | | No |
|
|
| verified | boolean | | No |
|
|
| version | string | | Yes |
|
|
|
|
#### PluginDeclarationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_strategy | object | | No |
|
|
| author | string | | Yes |
|
|
| category | [PluginCategory](#plugincategory) | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| datasource | object | | No |
|
|
| description | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | | Yes |
|
|
| endpoint | object | | No |
|
|
| icon | string | | Yes |
|
|
| icon_dark | string | | No |
|
|
| label | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | | Yes |
|
|
| meta | object | | Yes |
|
|
| model | [ProviderEntityResponse](#providerentityresponse) | | No |
|
|
| name | string | | Yes |
|
|
| plugins | object | | Yes |
|
|
| repo | string | | No |
|
|
| resource | object | | Yes |
|
|
| tags | [ string ] | | No |
|
|
| tool | object | | No |
|
|
| trigger | object | | No |
|
|
| verified | boolean | | No |
|
|
| version | string | | Yes |
|
|
|
|
#### PluginDecodeResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| manifest | [PluginDeclaration](#plugindeclaration) | | Yes |
|
|
| unique_identifier | string | The unique identifier of the plugin. | Yes |
|
|
| verification | [PluginVerification](#pluginverification) | Basic verification information | No |
|
|
|
|
#### PluginDependency
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| current_identifier | string | | No |
|
|
| type | [PluginDependencyType](#plugindependencytype) | | Yes |
|
|
| value | [Github](#github)<br>[Marketplace](#marketplace)<br>[Package](#package) | | Yes |
|
|
|
|
#### PluginDependencyType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| PluginDependencyType | string | | |
|
|
|
|
#### PluginDynamicOptionsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| options | [ [PluginParameterOption](#pluginparameteroption) ] | | Yes |
|
|
|
|
#### PluginEntity
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| checksum | string | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| declaration | [PluginDeclaration](#plugindeclaration) | | Yes |
|
|
| endpoints_active | integer | | Yes |
|
|
| endpoints_setups | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| installation_id | string | | Yes |
|
|
| meta | object | | Yes |
|
|
| name | string | | Yes |
|
|
| plugin_id | string | | Yes |
|
|
| plugin_unique_identifier | string | | Yes |
|
|
| runtime_type | string | | Yes |
|
|
| source | [PluginInstallationSource](#plugininstallationsource) | | Yes |
|
|
| tenant_id | string | | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
| version | string | | Yes |
|
|
|
|
#### PluginInstallTask
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| completed_plugins | integer | The number of plugins that have been installed. | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| id | string | | Yes |
|
|
| plugins | [ [PluginInstallTaskPluginStatus](#plugininstalltaskpluginstatus) ] | The status of the plugins. | Yes |
|
|
| status | [PluginInstallTaskStatus](#plugininstalltaskstatus) | The status of the install task. | Yes |
|
|
| total_plugins | integer | The total number of plugins to be installed. | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
|
|
#### PluginInstallTaskPluginStatus
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| icon | string | The icon of the plugin. | Yes |
|
|
| labels | [I18nObject](#i18nobject) | The labels of the plugin. | Yes |
|
|
| message | string | The message of the install task. | Yes |
|
|
| plugin_id | string | The plugin ID of the install task. | Yes |
|
|
| plugin_unique_identifier | string | The plugin unique identifier of the install task. | Yes |
|
|
| source | string | The installation source of the plugin | No |
|
|
| status | [PluginInstallTaskStatus](#plugininstalltaskstatus) | The status of the install task. | Yes |
|
|
|
|
#### PluginInstallTaskStartResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| all_installed | boolean | Whether all plugins are installed. | Yes |
|
|
| task | [PluginInstallTask](#plugininstalltask) | The install task. | No |
|
|
| task_id | string | The ID of the install task. | Yes |
|
|
|
|
#### PluginInstallTaskStatus
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| PluginInstallTaskStatus | string | | |
|
|
|
|
#### PluginInstallationItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| checksum | string | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| declaration | [PluginDeclarationResponse](#plugindeclarationresponse) | | Yes |
|
|
| endpoints_active | integer | | Yes |
|
|
| endpoints_setups | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| meta | object | | Yes |
|
|
| plugin_id | string | | Yes |
|
|
| plugin_unique_identifier | string | | Yes |
|
|
| runtime_type | string | | Yes |
|
|
| source | [PluginInstallationSource](#plugininstallationsource) | | Yes |
|
|
| tenant_id | string | | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
| version | string | | Yes |
|
|
|
|
#### PluginInstallationPermissionModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| plugin_installation_scope | [PluginInstallationScope](#plugininstallationscope) | | Yes |
|
|
| restrict_to_marketplace_only | boolean | | Yes |
|
|
|
|
#### PluginInstallationScope
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| PluginInstallationScope | string | | |
|
|
|
|
#### PluginInstallationSource
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| PluginInstallationSource | string | | |
|
|
|
|
#### PluginInstallationsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| plugins | [ [PluginInstallationItemResponse](#plugininstallationitemresponse) ] | | Yes |
|
|
|
|
#### PluginListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| plugins | [ [PluginEntity](#pluginentity) ] | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### PluginManifestResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| manifest | [PluginDeclaration](#plugindeclaration) | | Yes |
|
|
|
|
#### PluginOAuthAuthorizationUrlResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| authorization_url | string | The URL of the authorization. | Yes |
|
|
|
|
#### PluginOperationSuccessResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| message | string | | No |
|
|
| success | boolean | | Yes |
|
|
|
|
#### PluginParameterAutoGenerate
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| type | [PluginParameterAutoGenerateType](#pluginparameterautogeneratetype) | | Yes |
|
|
|
|
#### PluginParameterAutoGenerateType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| PluginParameterAutoGenerateType | string | | |
|
|
|
|
#### PluginParameterOption
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| icon | string | The icon of the option, can be a url or a base64 encoded image | No |
|
|
| label | [I18nObject](#i18nobject) | The label of the option | Yes |
|
|
| value | string | The value of the option | Yes |
|
|
|
|
#### PluginParameterTemplate
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | Whether the parameter is jinja enabled | No |
|
|
|
|
#### PluginPermissionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| debug_permission | [TenantPluginDebugPermission](#tenantplugindebugpermission) | | Yes |
|
|
| install_permission | [TenantPluginInstallPermission](#tenantplugininstallpermission) | | Yes |
|
|
|
|
#### PluginPermissionSettingsPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| debug_permission | [TenantPluginDebugPermission](#tenantplugindebugpermission) | | No |
|
|
| install_permission | [TenantPluginInstallPermission](#tenantplugininstallpermission) | | No |
|
|
|
|
#### PluginReadmeResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| readme | string | | Yes |
|
|
|
|
#### PluginResourceRequirements
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| memory | integer | | Yes |
|
|
| permission | [Permission](#permission) | | No |
|
|
|
|
#### PluginTaskResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| task | [PluginInstallTask](#plugininstalltask) | | Yes |
|
|
|
|
#### PluginTasksResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| tasks | [ [PluginInstallTask](#plugininstalltask) ] | | Yes |
|
|
|
|
#### PluginVerification
|
|
|
|
Verification of the plugin.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| authorized_category | [AuthorizedCategory](#authorizedcategory) | The authorized category of the plugin. | Yes |
|
|
|
|
#### PluginVersionsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| versions | object | | Yes |
|
|
|
|
#### Plugins
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| datasources | [ string ] | | No |
|
|
| endpoints | [ string ] | | No |
|
|
| models | [ string ] | | No |
|
|
| tools | [ string ] | | No |
|
|
| triggers | [ string ] | | No |
|
|
|
|
#### PreProcessingRule
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | Whether this preprocessing rule is enabled. | Yes |
|
|
| id | string, <br>**Available values:** "remove_extra_spaces", "remove_stopwords", "remove_urls_emails" | Rule identifier.<br>*Enum:* `"remove_extra_spaces"`, `"remove_stopwords"`, `"remove_urls_emails"` | Yes |
|
|
|
|
#### PreviewDetail
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| child_chunks | [ string ] | | No |
|
|
| content | string | | Yes |
|
|
| summary | string | | No |
|
|
|
|
#### PriceConfig
|
|
|
|
Model class for pricing info.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| currency | string | | Yes |
|
|
| input | string | | Yes |
|
|
| output | string | | No |
|
|
| unit | string | | Yes |
|
|
|
|
#### PriceConfigResponse
|
|
|
|
Serialized pricing info with codegen-safe decimal string patterns.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| currency | string | | Yes |
|
|
| input | string | | Yes |
|
|
| output | string | | No |
|
|
| unit | string | | Yes |
|
|
|
|
#### ProcessRule
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| mode | [ProcessRuleMode](#processrulemode) | Processing mode. `automatic` uses built-in rules, `custom` allows manual configuration, and `hierarchical` enables parent-child chunk structure for `doc_form: hierarchical_model`. | Yes |
|
|
| rules | [Rule](#rule) | Custom processing rules. | No |
|
|
|
|
#### ProcessRuleMode
|
|
|
|
Dataset Process Rule Mode
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ProcessRuleMode | string | Dataset Process Rule Mode | |
|
|
|
|
#### ProcessRuleResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| limits | object | | Yes |
|
|
| mode | [ProcessRuleMode](#processrulemode) | | Yes |
|
|
| rules | [Rule](#rule) | | No |
|
|
|
|
#### ProviderConfig
|
|
|
|
Model class for common provider settings like credentials
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| default | integer<br>string<br>number<br>boolean | | No |
|
|
| help | [I18nObject](#i18nobject) | | No |
|
|
| label | [I18nObject](#i18nobject) | | No |
|
|
| multiple | boolean | | No |
|
|
| name | string | The name of the credentials | Yes |
|
|
| options | [ [Option](#option) ] | | No |
|
|
| placeholder | [I18nObject](#i18nobject) | | No |
|
|
| required | boolean | | No |
|
|
| scope | [AppSelectorScope](#appselectorscope)<br>[ModelSelectorScope](#modelselectorscope)<br>[ToolSelectorScope](#toolselectorscope) | | No |
|
|
| type | [ProviderConfigType](#providerconfigtype) | The type of the credentials | Yes |
|
|
| url | string | | No |
|
|
|
|
#### ProviderConfigListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ProviderConfigListResponse | array | | |
|
|
|
|
#### ProviderConfigType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ProviderConfigType | string | | |
|
|
|
|
#### ProviderCredentialSchema
|
|
|
|
Model class for provider credential schema.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_form_schemas | [ [CredentialFormSchema](#credentialformschema) ] | | Yes |
|
|
|
|
#### ProviderCredentialsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | object | | No |
|
|
|
|
#### ProviderEntity
|
|
|
|
Runtime-native provider schema.
|
|
|
|
`provider` is the canonical runtime identifier. `provider_name` is a
|
|
compatibility alias for callers that still resolve providers by short name and
|
|
is empty when no alias exists.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| background | string | | No |
|
|
| configurate_methods | [ [ConfigurateMethod](#configuratemethod) ] | | Yes |
|
|
| description | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | No |
|
|
| help | [ProviderHelpEntity](#providerhelpentity) | | No |
|
|
| icon_small | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | No |
|
|
| icon_small_dark | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | No |
|
|
| label | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | Yes |
|
|
| model_credential_schema | [ModelCredentialSchema](#modelcredentialschema) | | No |
|
|
| models | [ [AIModelEntity](#aimodelentity) ] | | No |
|
|
| position | object | | No |
|
|
| provider | string | | Yes |
|
|
| provider_credential_schema | [ProviderCredentialSchema](#providercredentialschema) | | No |
|
|
| provider_name | string | | No |
|
|
| supported_model_types | [ [ModelType](#modeltype) ] | | Yes |
|
|
|
|
#### ProviderEntityResponse
|
|
|
|
Runtime provider response with codegen-safe model pricing schemas.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| background | string | | No |
|
|
| configurate_methods | [ [ConfigurateMethod](#configuratemethod) ] | | Yes |
|
|
| description | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | No |
|
|
| help | [ProviderHelpEntity](#providerhelpentity) | | No |
|
|
| icon_small | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | No |
|
|
| icon_small_dark | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | No |
|
|
| label | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | Yes |
|
|
| model_credential_schema | [ModelCredentialSchema](#modelcredentialschema) | | No |
|
|
| models | [ [AIModelEntityResponse](#aimodelentityresponse) ], <br>**Default:** | | No |
|
|
| position | object | | No |
|
|
| provider | string | | Yes |
|
|
| provider_credential_schema | [ProviderCredentialSchema](#providercredentialschema) | | No |
|
|
| provider_name | string | | No |
|
|
| supported_model_types | [ [ModelType](#modeltype) ] | | Yes |
|
|
|
|
#### ProviderHelpEntity
|
|
|
|
Model class for provider help.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| title | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | Yes |
|
|
| url | [graphon__model_runtime__entities__common_entities__I18nObject](#graphon__model_runtime__entities__common_entities__i18nobject) | | Yes |
|
|
|
|
#### ProviderModelListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ModelWithProviderEntityResponse](#modelwithproviderentityresponse) ] | | Yes |
|
|
|
|
#### ProviderModelWithStatusEntity
|
|
|
|
Model class for model response.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| deprecated | boolean | | No |
|
|
| features | [ [ModelFeature](#modelfeature) ] | | No |
|
|
| fetch_from | [FetchFrom](#fetchfrom) | | Yes |
|
|
| has_invalid_load_balancing_configs | boolean | | No |
|
|
| label | [I18nObject](#i18nobject) | | Yes |
|
|
| load_balancing_enabled | boolean | | No |
|
|
| model | string | | Yes |
|
|
| model_properties | object | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
| status | [ModelStatus](#modelstatus) | | Yes |
|
|
|
|
#### ProviderQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| provider | string | | Yes |
|
|
|
|
#### ProviderQuotaType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ProviderQuotaType | string | | |
|
|
|
|
#### ProviderResponse
|
|
|
|
Model class for provider response.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| background | string | | No |
|
|
| configurate_methods | [ [ConfigurateMethod](#configuratemethod) ] | | Yes |
|
|
| custom_configuration | [CustomConfigurationResponse](#customconfigurationresponse) | | Yes |
|
|
| description | [I18nObject](#i18nobject) | | No |
|
|
| help | [ProviderHelpEntity](#providerhelpentity) | | No |
|
|
| icon_small | [I18nObject](#i18nobject) | | No |
|
|
| icon_small_dark | [I18nObject](#i18nobject) | | No |
|
|
| label | [I18nObject](#i18nobject) | | Yes |
|
|
| model_credential_schema | [ModelCredentialSchema](#modelcredentialschema) | | No |
|
|
| preferred_provider_type | [ProviderType](#providertype) | | Yes |
|
|
| provider | string | | Yes |
|
|
| provider_credential_schema | [ProviderCredentialSchema](#providercredentialschema) | | No |
|
|
| supported_model_types | [ [ModelType](#modeltype) ] | | Yes |
|
|
| system_configuration | [SystemConfigurationResponse](#systemconfigurationresponse) | | Yes |
|
|
| tenant_id | string | | Yes |
|
|
|
|
#### ProviderType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ProviderType | string | | |
|
|
|
|
#### ProviderWithModelsResponse
|
|
|
|
Model class for provider with models response.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| icon_small | [I18nObject](#i18nobject) | | No |
|
|
| icon_small_dark | [I18nObject](#i18nobject) | | No |
|
|
| label | [I18nObject](#i18nobject) | | Yes |
|
|
| models | [ [ProviderModelWithStatusEntity](#providermodelwithstatusentity) ] | | Yes |
|
|
| provider | string | | Yes |
|
|
| status | [CustomConfigurationStatus](#customconfigurationstatus) | | Yes |
|
|
| tenant_id | string | | Yes |
|
|
|
|
#### PublishWorkflowPayload
|
|
|
|
Payload for publishing snippet workflow.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| knowledge_base_setting | object | | No |
|
|
| marked_comment | string | | No |
|
|
| marked_name | string | | No |
|
|
|
|
#### PublishedWorkflowRunPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| datasource_info_list | [ object ] | | Yes |
|
|
| datasource_type | string | | Yes |
|
|
| inputs | object | | Yes |
|
|
| is_preview | boolean | | No |
|
|
| original_document_id | string | | No |
|
|
| response_mode | string, <br>**Available values:** "blocking", "streaming", <br>**Default:** streaming | *Enum:* `"blocking"`, `"streaming"` | No |
|
|
| start_node_id | string | | Yes |
|
|
|
|
#### QAPreviewDetail
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | Yes |
|
|
| question | string | | Yes |
|
|
|
|
#### Quota
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| limit | integer | | Yes |
|
|
| reset_date | integer, <br>**Default:** -1 | | Yes |
|
|
| usage | integer | | Yes |
|
|
|
|
#### QuotaConfiguration
|
|
|
|
Model class for provider quota configuration.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| is_valid | boolean | | Yes |
|
|
| quota_limit | integer | | Yes |
|
|
| quota_type | [ProviderQuotaType](#providerquotatype) | | Yes |
|
|
| quota_unit | [QuotaUnit](#quotaunit) | | Yes |
|
|
| quota_used | integer | | Yes |
|
|
| restrict_models | [ [RestrictModel](#restrictmodel) ], <br>**Default:** | | No |
|
|
|
|
#### QuotaUnit
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| QuotaUnit | string | | |
|
|
|
|
#### RBACResourceWhitelistScope
|
|
|
|
Whitelist scopes accepted by RBAC app and dataset access config APIs.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| RBACResourceWhitelistScope | string | Whitelist scopes accepted by RBAC app and dataset access config APIs. | |
|
|
|
|
#### RBACRole
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| category | string | | No |
|
|
| description | string | | No |
|
|
| id | string | | Yes |
|
|
| is_builtin | boolean | | No |
|
|
| name | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
| role_tag | string | | No |
|
|
| tenant_id | string | | No |
|
|
| type | string | | Yes |
|
|
|
|
#### RBACRoleAccount
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| account_id | string | | Yes |
|
|
| account_name | string | | No |
|
|
| avatar | string | | No |
|
|
| email | string | | No |
|
|
|
|
#### RagPipelineDatasetImportPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| yaml_content | string | | Yes |
|
|
|
|
#### RagPipelineImportCheckDependenciesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| leaked_dependencies | [ [PluginDependency](#plugindependency) ] | | No |
|
|
|
|
#### RagPipelineImportPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| mode | string | | Yes |
|
|
| name | string | | No |
|
|
| pipeline_id | string | | No |
|
|
| yaml_content | string | | No |
|
|
| yaml_url | string | | No |
|
|
|
|
#### RagPipelineImportResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| current_dsl_version | string | | Yes |
|
|
| dataset_id | string | | No |
|
|
| error | string | | No |
|
|
| id | string | | Yes |
|
|
| imported_dsl_version | string | | Yes |
|
|
| pipeline_id | string | | No |
|
|
| status | [ImportStatus](#importstatus) | | Yes |
|
|
|
|
#### RagPipelineOpaqueResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| RagPipelineOpaqueResponse | | | |
|
|
|
|
#### RagPipelineRecommendedPluginQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| type | string, <br>**Default:** all | | No |
|
|
|
|
#### RagPipelineStepParametersResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| variables | | | Yes |
|
|
|
|
#### RagPipelineWorkflowPublishResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | Yes |
|
|
| result | string | | Yes |
|
|
|
|
#### RagPipelineWorkflowSyncResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| hash | string | | Yes |
|
|
| result | string | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
|
|
#### RecentAppListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [RecentAppResponse](#recentappresponse) ] | | Yes |
|
|
|
|
#### RecentAppResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| author_name | string | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | [IconType](#icontype) | | No |
|
|
| icon_url | string | | Yes |
|
|
| id | string | | Yes |
|
|
| maintainer | string | | No |
|
|
| mode | string, <br>**Available values:** "advanced-chat", "agent-chat", "chat", "completion", "workflow" | *Enum:* `"advanced-chat"`, `"agent-chat"`, `"chat"`, `"completion"`, `"workflow"` | Yes |
|
|
| name | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
| updated_at | integer | | Yes |
|
|
|
|
#### RecommendedAppDetailNullableResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| RecommendedAppDetailNullableResponse | [RecommendedAppDetailResponse](#recommendedappdetailresponse) | | |
|
|
|
|
#### RecommendedAppDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| can_trial | boolean | | Yes |
|
|
| export_data | string | | Yes |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| id | string | | Yes |
|
|
| mode | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### RecommendedAppInfoResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| icon_url | string | | Yes |
|
|
| id | string | | Yes |
|
|
| mode | string | | No |
|
|
| name | string | | No |
|
|
|
|
#### RecommendedAppListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| categories | [ string ] | | Yes |
|
|
| recommended_apps | [ [RecommendedAppResponse](#recommendedappresponse) ] | | Yes |
|
|
|
|
#### RecommendedAppResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app | [RecommendedAppInfoResponse](#recommendedappinforesponse) | | No |
|
|
| app_id | string | | Yes |
|
|
| can_trial | boolean | | Yes |
|
|
| categories | [ string ] | | No |
|
|
| copyright | string | | No |
|
|
| custom_disclaimer | string | | No |
|
|
| description | string | | No |
|
|
| is_listed | boolean | | No |
|
|
| position | integer | | No |
|
|
| privacy_policy | string | | No |
|
|
|
|
#### RecommendedAppsQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| language | string | Language code for recommended app localization | No |
|
|
|
|
#### RedirectResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| RedirectResponse | string | | |
|
|
|
|
#### RedirectUrlResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| redirect_url | string | | Yes |
|
|
|
|
#### RelatedAppListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [RelatedAppResponse](#relatedappresponse) ] | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### RelatedAppResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | Yes |
|
|
| icon | string | | Yes |
|
|
| icon_background | string | | Yes |
|
|
| icon_type | string | | Yes |
|
|
| icon_url | string | | No |
|
|
| id | string | | Yes |
|
|
| mode | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### RemoteFileInfo
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| file_length | integer | | Yes |
|
|
| file_type | string | | Yes |
|
|
|
|
#### RemoteFileUploadPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| url | string | URL to fetch | Yes |
|
|
|
|
#### ReplaceUserAccessPolicies
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_policy_ids | [ string ] | | No |
|
|
| account_ids | [ string ] | | No |
|
|
|
|
#### ReplaceUserAccessPoliciesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_policies | [ [AccessPolicy](#accesspolicy) ] | | No |
|
|
|
|
#### RequestLog
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | dateTime | The created at of the request log | Yes |
|
|
| endpoint | string | The endpoint of the request log | Yes |
|
|
| id | string | The id of the request log | Yes |
|
|
| request | object | The request of the request log | Yes |
|
|
| response | object | The response of the request log | Yes |
|
|
|
|
#### RerankingModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| reranking_model_name | string | Name of the reranking model. | No |
|
|
| reranking_provider_name | string | Provider name of the reranking model. | No |
|
|
|
|
#### ResourcePermissionKeys
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| permission_keys | [ string ] | | No |
|
|
| resource_id | string | | Yes |
|
|
|
|
#### ResourcePermissionSnapshot
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| default_permission_keys | [ string ] | | No |
|
|
| overrides | [ [ResourcePermissionKeys](#resourcepermissionkeys) ] | | No |
|
|
|
|
#### ResourceUserAccessPolicies
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_policies | [ [AccessPolicy](#accesspolicy) ] | | No |
|
|
| account | [RBACRoleAccount](#rbacroleaccount) | | Yes |
|
|
| roles | [ [RBACRole](#rbacrole) ] | | No |
|
|
|
|
#### ResourceUserAccessPoliciesResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [ResourceUserAccessPolicies](#resourceuseraccesspolicies) ] | | No |
|
|
| scope | [RBACResourceWhitelistScope](#rbacresourcewhitelistscope) | | Yes |
|
|
|
|
#### ResourceWhitelist
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| account_ids | [ string ] | | No |
|
|
|
|
#### RestrictModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| base_model_name | string | | No |
|
|
| model | string | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
|
|
#### ResultResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | | Yes |
|
|
|
|
#### RetrievalMethod
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| RetrievalMethod | string | | |
|
|
|
|
#### RetrievalModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| metadata_filtering_conditions | [MetadataFilteringCondition](#metadatafilteringcondition) | Restrict retrieval to chunks whose document metadata matches the given conditions. Conditions are evaluated server-side against document metadata fields. | No |
|
|
| reranking_enable | boolean | Whether reranking is enabled. | Yes |
|
|
| reranking_mode | string | Reranking mode. Required when `reranking_enable` is `true`. | No |
|
|
| reranking_model | [RerankingModel](#rerankingmodel) | Reranking model configuration. | No |
|
|
| score_threshold | number | Minimum similarity score for results. Only effective when score threshold filtering is enabled. | No |
|
|
| score_threshold_enabled | boolean | Whether score threshold filtering is enabled. | Yes |
|
|
| search_method | [RetrievalMethod](#retrievalmethod) | Search method used for retrieval. | Yes |
|
|
| top_k | integer | Maximum number of results to return. | Yes |
|
|
| weights | [WeightModel](#weightmodel) | Weight configuration for hybrid search. | No |
|
|
|
|
#### RetrievalSettingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| retrieval_method | [ string ] | | Yes |
|
|
|
|
#### RetrieverResource
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | No |
|
|
| created_at | integer | | No |
|
|
| data_source_type | string | | No |
|
|
| dataset_id | string | | No |
|
|
| dataset_name | string | | No |
|
|
| document_id | string | | No |
|
|
| document_name | string | | No |
|
|
| hit_count | integer | | No |
|
|
| id | string | | No |
|
|
| index_node_hash | string | | No |
|
|
| message_id | string | | No |
|
|
| position | integer | | Yes |
|
|
| score | number | | No |
|
|
| segment_id | string | | No |
|
|
| segment_position | integer | | No |
|
|
| summary | string | | No |
|
|
| word_count | integer | | No |
|
|
|
|
#### RoleBindingsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AccessPolicyRoleBinding](#accesspolicyrolebinding) ] | | No |
|
|
|
|
#### RosterListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword | string | | No |
|
|
| limit | integer, <br>**Default:** 20 | | No |
|
|
| page | integer, <br>**Default:** 1 | | No |
|
|
|
|
#### Rule
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| parent_mode | string | Parent-child segmentation mode. | No |
|
|
| pre_processing_rules | [ [PreProcessingRule](#preprocessingrule) ] | Pre-processing rules to apply before segmentation. | No |
|
|
| segmentation | [Segmentation](#segmentation) | Parent chunk segmentation settings. | No |
|
|
| subchunk_segmentation | [Segmentation](#segmentation) | Child chunk segmentation settings. | No |
|
|
|
|
#### RuleCodeGeneratePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code_language | string, <br>**Default:** javascript | Programming language for code generation | No |
|
|
| instruction | string | Rule generation instruction | Yes |
|
|
| model_config | [ModelConfig](#modelconfig) | Model configuration | Yes |
|
|
| no_variable | boolean | Whether to exclude variables | No |
|
|
|
|
#### RuleGeneratePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| instruction | string | Rule generation instruction | Yes |
|
|
| model_config | [ModelConfig](#modelconfig) | Model configuration | Yes |
|
|
| no_variable | boolean | Whether to exclude variables | No |
|
|
|
|
#### RuleStructuredOutputPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| instruction | string | Structured output generation instruction | Yes |
|
|
| model_config | [ModelConfig](#modelconfig) | Model configuration | Yes |
|
|
|
|
#### SandboxFileEntryResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| mtime | integer | | No |
|
|
| name | string | | Yes |
|
|
| size | integer | | No |
|
|
| type | string, <br>**Available values:** "dir", "file", "other", "symlink" | *Enum:* `"dir"`, `"file"`, `"other"`, `"symlink"` | Yes |
|
|
|
|
#### SandboxInfoResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| session_id | string | | Yes |
|
|
| workspace_cwd | string | | Yes |
|
|
|
|
#### SandboxListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| entries | [ [SandboxFileEntryResponse](#sandboxfileentryresponse) ] | | No |
|
|
| path | string | | Yes |
|
|
| truncated | boolean | | No |
|
|
|
|
#### SandboxReadResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| binary | boolean | | Yes |
|
|
| path | string | | Yes |
|
|
| size | integer | | No |
|
|
| text | string | | No |
|
|
| truncated | boolean | | Yes |
|
|
|
|
#### SandboxUploadResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| url | string | | Yes |
|
|
|
|
#### SavedMessageCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| message_id | string | | Yes |
|
|
|
|
#### SavedMessageInfiniteScrollPagination
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [SavedMessageItem](#savedmessageitem) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
|
|
#### SavedMessageItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | Yes |
|
|
| created_at | integer | | No |
|
|
| feedback | [SimpleFeedback](#simplefeedback) | | No |
|
|
| id | string | | Yes |
|
|
| inputs | object | | Yes |
|
|
| message_files | [ [MessageFile](#messagefile) ] | | Yes |
|
|
| query | string | | Yes |
|
|
|
|
#### SavedMessageListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| last_id | string | | No |
|
|
| limit | integer, <br>**Default:** 20 | | No |
|
|
|
|
#### SchemaDefinitionItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| label | string | | Yes |
|
|
| name | string | | Yes |
|
|
| schema | object | | Yes |
|
|
|
|
#### SchemaDefinitionsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| SchemaDefinitionsResponse | array | | |
|
|
|
|
#### SegmentAttachmentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| extension | string | | Yes |
|
|
| id | string | | Yes |
|
|
| mime_type | string | | Yes |
|
|
| name | string | | Yes |
|
|
| size | integer | | Yes |
|
|
| source_url | string | | Yes |
|
|
|
|
#### SegmentBatchImportStatusResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| job_id | string | | Yes |
|
|
| job_status | string | | Yes |
|
|
|
|
#### SegmentCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | No |
|
|
| attachment_ids | [ string ] | | No |
|
|
| content | string | | Yes |
|
|
| keywords | [ string ] | | No |
|
|
|
|
#### SegmentDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [SegmentResponse](#segmentresponse) | | Yes |
|
|
| doc_form | string | | Yes |
|
|
|
|
#### SegmentIdListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| segment_id | [ string ] | Segment IDs | No |
|
|
|
|
#### SegmentListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | string, <br>**Default:** all | | No |
|
|
| hit_count_gte | integer | | No |
|
|
| keyword | string | | No |
|
|
| limit | integer, <br>**Default:** 20 | | No |
|
|
| page | integer, <br>**Default:** 1 | | No |
|
|
| status | [ string ] | | No |
|
|
|
|
#### SegmentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | Yes |
|
|
| attachments | [ [SegmentAttachmentResponse](#segmentattachmentresponse) ] | | Yes |
|
|
| child_chunks | [ [ChildChunkResponse](#childchunkresponse) ] | | Yes |
|
|
| completed_at | integer | | Yes |
|
|
| content | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| created_by | string | | Yes |
|
|
| disabled_at | integer | | Yes |
|
|
| disabled_by | string | | Yes |
|
|
| document_id | string | | Yes |
|
|
| enabled | boolean | | Yes |
|
|
| error | string | | Yes |
|
|
| hit_count | integer | | Yes |
|
|
| id | string | | Yes |
|
|
| index_node_hash | string | | Yes |
|
|
| index_node_id | string | | Yes |
|
|
| indexing_at | integer | | Yes |
|
|
| keywords | [ string ] | | Yes |
|
|
| position | integer | | Yes |
|
|
| sign_content | string | | Yes |
|
|
| status | string | | Yes |
|
|
| stopped_at | integer | | Yes |
|
|
| summary | string | | Yes |
|
|
| tokens | integer | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
| updated_by | string | | Yes |
|
|
| word_count | integer | | Yes |
|
|
|
|
#### SegmentUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | No |
|
|
| attachment_ids | [ string ] | | No |
|
|
| content | string | | Yes |
|
|
| keywords | [ string ] | | No |
|
|
| regenerate_child_chunks | boolean | | No |
|
|
| summary | string | | No |
|
|
|
|
#### Segmentation
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| chunk_overlap | integer | Token overlap between chunks. | No |
|
|
| max_tokens | integer | Maximum token count per chunk. | Yes |
|
|
| separator | string, <br>**Default:**
|
|
| Custom separator for splitting text. | No |
|
|
|
|
#### SelectInputConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| option_source | [StringListSource](#stringlistsource) | | Yes |
|
|
| output_variable_name | string | | Yes |
|
|
| type | string | | No |
|
|
|
|
#### SimpleAccount
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | Yes |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### SimpleAccountResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | Yes |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### SimpleConversation
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| id | string | | Yes |
|
|
| inputs | object | | Yes |
|
|
| introduction | string | | No |
|
|
| name | string | | Yes |
|
|
| status | string | | Yes |
|
|
| updated_at | integer | | No |
|
|
|
|
#### SimpleDataResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | string | | Yes |
|
|
|
|
#### SimpleEndUser
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| is_anonymous | boolean | | Yes |
|
|
| session_id | string | | No |
|
|
| type | string | | Yes |
|
|
|
|
#### SimpleFeedback
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| rating | string | | No |
|
|
|
|
#### SimpleMessageDetail
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| answer | string | | Yes |
|
|
| inputs | object | | Yes |
|
|
| message | string | | Yes |
|
|
| query | string | | Yes |
|
|
|
|
#### SimpleMessageResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| message | string | | Yes |
|
|
|
|
#### SimpleModelConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| model | [JSONValue](#jsonvalue) | | No |
|
|
| pre_prompt | string | | No |
|
|
|
|
#### SimpleProviderEntityResponse
|
|
|
|
Simple provider entity response.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| icon_small | [I18nObject](#i18nobject) | | No |
|
|
| icon_small_dark | [I18nObject](#i18nobject) | | No |
|
|
| label | [I18nObject](#i18nobject) | | Yes |
|
|
| models | [ [AIModelEntityResponse](#aimodelentityresponse) ], <br>**Default:** | | No |
|
|
| provider | string | | Yes |
|
|
| provider_name | string | | No |
|
|
| supported_model_types | [ [ModelType](#modeltype) ] | | Yes |
|
|
| tenant_id | string | | Yes |
|
|
|
|
#### SimpleResultDataResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | string | | Yes |
|
|
| result | string | | Yes |
|
|
|
|
#### SimpleResultMessageResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| message | string | | Yes |
|
|
| result | string | | Yes |
|
|
|
|
#### SimpleResultOptionalDataResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | string | | No |
|
|
| result | string | | Yes |
|
|
|
|
#### SimpleResultResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | | Yes |
|
|
|
|
#### Site
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| chat_color_theme | string | | No |
|
|
| chat_color_theme_inverted | boolean | | Yes |
|
|
| copyright | string | | No |
|
|
| custom_disclaimer | string | | No |
|
|
| default_language | string | | Yes |
|
|
| description | string | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | string | | No |
|
|
| icon_url | string | | Yes |
|
|
| input_placeholder | string | | No |
|
|
| privacy_policy | string | | No |
|
|
| show_workflow_steps | boolean | | Yes |
|
|
| title | string | | Yes |
|
|
| use_icon_as_answer_icon | boolean | | Yes |
|
|
|
|
#### SkillManifest
|
|
|
|
Validated metadata extracted from a Skill package.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | Yes |
|
|
| entry_path | string | | Yes |
|
|
| files | [ string ] | | Yes |
|
|
| hash | string | | Yes |
|
|
| name | string | | Yes |
|
|
| size | integer | | Yes |
|
|
|
|
#### SkillToolInferenceResult
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| cli_tools | [ [CliToolSuggestion](#clitoolsuggestion) ] | | No |
|
|
| inferable | boolean | | Yes |
|
|
| reason | string | | No |
|
|
|
|
#### SnippetDependencyCheckResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| leaked_dependencies | [ [PluginDependency](#plugindependency) ] | | Yes |
|
|
|
|
#### SnippetDraftConfigResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| parallel_depth_limit | integer | | Yes |
|
|
|
|
#### SnippetDraftNodeRunPayload
|
|
|
|
Payload for running a single node in snippet draft workflow.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ object ] | | No |
|
|
| inputs | object | | Yes |
|
|
| query | string | | No |
|
|
|
|
#### SnippetDraftRunPayload
|
|
|
|
Payload for running snippet draft workflow.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ object ] | | No |
|
|
| inputs | object | | Yes |
|
|
|
|
#### SnippetDraftSyncPayload
|
|
|
|
Payload for syncing snippet draft workflow.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_variables | [ object ] | Ignored. Snippet workflows do not persist conversation variables. | No |
|
|
| graph | object | | Yes |
|
|
| hash | string | | No |
|
|
| input_fields | [ object ] | | No |
|
|
|
|
#### SnippetImportPayload
|
|
|
|
Payload for importing snippet from DSL.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | Override snippet description | No |
|
|
| mode | string | Import mode: yaml-content or yaml-url | Yes |
|
|
| name | string | Override snippet name | No |
|
|
| snippet_id | string | Snippet ID to update (optional) | No |
|
|
| yaml_content | string | YAML content (required for yaml-content mode) | No |
|
|
| yaml_url | string | YAML URL (required for yaml-url mode) | No |
|
|
|
|
#### SnippetImportResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| current_dsl_version | string | | Yes |
|
|
| error | string | | Yes |
|
|
| id | string | | Yes |
|
|
| imported_dsl_version | string | | Yes |
|
|
| snippet_id | string | | Yes |
|
|
| status | [ImportStatus](#importstatus) | | Yes |
|
|
| warnings | [ [DslImportWarning](#dslimportwarning) ] | | Yes |
|
|
|
|
#### SnippetIterationNodeRunPayload
|
|
|
|
Payload for running an iteration node in snippet draft workflow.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| inputs | object | | No |
|
|
|
|
#### SnippetListItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| author_name | string | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| created_by | string | | Yes |
|
|
| description | string | | Yes |
|
|
| icon_info | object | | Yes |
|
|
| id | string | | Yes |
|
|
| is_published | boolean | | Yes |
|
|
| name | string | | Yes |
|
|
| tags | [ [SnippetTagResponse](#snippettagresponse) ] | | Yes |
|
|
| type | [SnippetType](#snippettype) | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
| updated_by | string | | Yes |
|
|
| use_count | integer | | Yes |
|
|
| version | integer | | Yes |
|
|
|
|
#### SnippetListQuery
|
|
|
|
Query parameters for listing snippets.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| creators | [ string ] | Filter by creator account IDs | No |
|
|
| is_published | boolean | Filter by published status | No |
|
|
| keyword | string | | No |
|
|
| limit | integer, <br>**Default:** 20 | | No |
|
|
| page | integer, <br>**Default:** 1 | | No |
|
|
| tag_ids | [ string ] | Filter by tag IDs | No |
|
|
|
|
#### SnippetLoopNodeRunPayload
|
|
|
|
Payload for running a loop node in snippet draft workflow.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| inputs | object | | No |
|
|
|
|
#### SnippetPaginationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [SnippetListItemResponse](#snippetlistitemresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### SnippetResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | Yes |
|
|
| created_by | [SimpleAccountResponse](#simpleaccountresponse) | | Yes |
|
|
| description | string | | Yes |
|
|
| graph | object | | Yes |
|
|
| icon_info | object | | Yes |
|
|
| id | string | | Yes |
|
|
| input_fields | [ object ] | | Yes |
|
|
| is_published | boolean | | Yes |
|
|
| name | string | | Yes |
|
|
| tags | [ [SnippetTagResponse](#snippettagresponse) ] | | Yes |
|
|
| type | [SnippetType](#snippettype) | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
| updated_by | [SimpleAccountResponse](#simpleaccountresponse) | | Yes |
|
|
| use_count | integer | | Yes |
|
|
| version | integer | | Yes |
|
|
|
|
#### SnippetTagResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### SnippetType
|
|
|
|
Snippet Type Enum
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| SnippetType | string | Snippet Type Enum | |
|
|
|
|
#### SnippetUseCountResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | | Yes |
|
|
| use_count | integer | | Yes |
|
|
|
|
#### SnippetWorkflowListQuery
|
|
|
|
Query parameters for listing snippet published workflows.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| limit | integer, <br>**Default:** 10 | | No |
|
|
| page | integer, <br>**Default:** 1 | | No |
|
|
|
|
#### SnippetWorkflowPaginationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| has_more | boolean | | Yes |
|
|
| items | [ [SnippetWorkflowResponse](#snippetworkflowresponse) ] | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
|
|
#### SnippetWorkflowResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_variables | [ [WorkflowConversationVariableResponse](#workflowconversationvariableresponse) ] | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| created_by | [SimpleAccountResponse](#simpleaccountresponse) | | No |
|
|
| environment_variables | [ [WorkflowEnvironmentVariableResponse](#workflowenvironmentvariableresponse) ] | | Yes |
|
|
| features | object | | Yes |
|
|
| graph | object | | Yes |
|
|
| hash | string | | Yes |
|
|
| id | string | | Yes |
|
|
| input_fields | [ object ] | | No |
|
|
| marked_comment | string | | Yes |
|
|
| marked_name | string | | Yes |
|
|
| rag_pipeline_variables | [ [PipelineVariableResponse](#pipelinevariableresponse) ] | | Yes |
|
|
| tool_published | boolean | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
| updated_by | [SimpleAccountResponse](#simpleaccountresponse) | | No |
|
|
| version | string | | Yes |
|
|
|
|
#### StarredAppListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| creator_ids | [ string ] | Filter by creator account IDs | No |
|
|
| is_created_by_me | boolean | Filter by creator | No |
|
|
| limit | integer, <br>**Default:** 20 | Page size (1-100) | No |
|
|
| mode | string, <br>**Available values:** "advanced-chat", "agent", "agent-chat", "all", "channel", "chat", "completion", "workflow", <br>**Default:** all | App mode filter<br>*Enum:* `"advanced-chat"`, `"agent"`, `"agent-chat"`, `"all"`, `"channel"`, `"chat"`, `"completion"`, `"workflow"` | No |
|
|
| name | string | Filter by app name | No |
|
|
| page | integer, <br>**Default:** 1 | Page number (1-99999) | No |
|
|
| sort_by | string, <br>**Available values:** "earliest_created", "last_modified", "recently_created", <br>**Default:** last_modified | Sort apps by last modified, recently created, or earliest created<br>*Enum:* `"earliest_created"`, `"last_modified"`, `"recently_created"` | No |
|
|
| tag_ids | [ string ] | Filter by tag IDs | No |
|
|
|
|
#### StatisticTimeRangeQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| end | string | End date (YYYY-MM-DD HH:MM) | No |
|
|
| start | string | Start date (YYYY-MM-DD HH:MM) | No |
|
|
|
|
#### StatusCount
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| failed | integer | | Yes |
|
|
| partial_success | integer | | Yes |
|
|
| paused | integer | | Yes |
|
|
| success | integer | | Yes |
|
|
|
|
#### StepByStepTourStatePatchPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| action | string, <br>**Available values:** "complete_task", "disable_current_workspace", "enable_current_workspace", "skip", "uncomplete_task" | State update action<br>*Enum:* `"complete_task"`, `"disable_current_workspace"`, `"enable_current_workspace"`, `"skip"`, `"uncomplete_task"` | Yes |
|
|
| task_id | string | Task ID for task actions | No |
|
|
|
|
#### StepByStepTourStateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| completed_task_ids | [ string, <br>**Available values:** "home", "integration", "knowledge", "studio" ] | | No |
|
|
| first_workspace_id | string | | No |
|
|
| manually_disabled_workspace_ids | [ string ] | | No |
|
|
| manually_enabled_workspace_ids | [ string ] | | No |
|
|
| skipped | boolean | | No |
|
|
| updated_at | string | | No |
|
|
|
|
#### Storage
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | No |
|
|
| size | integer, <br>**Default:** 1048576 | | No |
|
|
|
|
#### StringListSource
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| selector | [ string ] | | No |
|
|
| type | [ValueSourceType](#valuesourcetype) | | Yes |
|
|
| value | [ string ] | | No |
|
|
|
|
#### StringSource
|
|
|
|
Default configuration for form inputs.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| selector | [ string ] | | No |
|
|
| type | [ValueSourceType](#valuesourcetype) | | Yes |
|
|
| value | string | | No |
|
|
|
|
#### SubscriptionBuilderApiEntity
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_type | [CredentialType](#credentialtype) | The credential type of the subscription builder | Yes |
|
|
| credentials | object | The credentials of the subscription builder | Yes |
|
|
| endpoint | string | The endpoint id of the subscription builder | Yes |
|
|
| id | string | The id of the subscription builder | Yes |
|
|
| name | string | The name of the subscription builder | Yes |
|
|
| parameters | object | The parameters of the subscription builder | Yes |
|
|
| properties | object | The properties of the subscription builder | Yes |
|
|
| provider | string | The provider id of the subscription builder | Yes |
|
|
|
|
#### SubscriptionConstructor
|
|
|
|
The subscription constructor of the trigger provider
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials_schema | [ [ProviderConfig](#providerconfig) ] | The credentials schema of the subscription constructor | No |
|
|
| oauth_schema | [OAuthSchema](#oauthschema) | The OAuth schema of the subscription constructor if OAuth is supported | No |
|
|
| parameters | [ [EventParameter](#eventparameter) ] | The parameters schema of the subscription constructor | No |
|
|
|
|
#### SubscriptionModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| interval | string | | Yes |
|
|
| plan | string, <br>**Default:** sandbox | | Yes |
|
|
|
|
#### SubscriptionQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| interval | string, <br>**Available values:** "month", "year" | Billing interval<br>*Enum:* `"month"`, `"year"` | Yes |
|
|
| plan | string, <br>**Available values:** "professional", "team" | Subscription plan<br>*Enum:* `"professional"`, `"team"` | Yes |
|
|
|
|
#### SuccessResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| success | boolean | | Yes |
|
|
|
|
#### SuggestedQuestionsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ string ] | | Yes |
|
|
|
|
#### SummaryEntryResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| error | string | | No |
|
|
| segment_id | string | | Yes |
|
|
| segment_position | integer | | Yes |
|
|
| status | string | | Yes |
|
|
| summary_preview | string | | No |
|
|
| updated_at | integer | | No |
|
|
|
|
#### SummaryStatusResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| completed | integer | | No |
|
|
| error | integer | | No |
|
|
| generating | integer | | No |
|
|
| not_started | integer | | No |
|
|
| timeout | integer | | No |
|
|
|
|
#### SwitchWorkspacePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| tenant_id | string | | Yes |
|
|
|
|
#### SwitchWorkspaceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| new_tenant | [TenantInfoResponse](#tenantinforesponse) | | Yes |
|
|
| result | string | | Yes |
|
|
|
|
#### SyncDraftWorkflowPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| _is_collaborative | boolean | | No |
|
|
| conversation_variables | [ object ] | | No |
|
|
| environment_variables | [ object ] | | No |
|
|
| features | object | | Yes |
|
|
| graph | object | | Yes |
|
|
| hash | string | | No |
|
|
|
|
#### SyncDraftWorkflowResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| hash | string | | Yes |
|
|
| result | string | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
|
|
#### SystemConfigurationResponse
|
|
|
|
Model class for provider system configuration response.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| current_quota_type | [ProviderQuotaType](#providerquotatype) | | No |
|
|
| enabled | boolean | | Yes |
|
|
| quota_configurations | [ [QuotaConfiguration](#quotaconfiguration) ], <br>**Default:** | | No |
|
|
|
|
#### SystemFeatureModel
|
|
|
|
Non-sensitive bootstrap snapshot exposed before Console or Web authentication.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| branding | [BrandingModel](#brandingmodel) | | Yes |
|
|
| deployment_edition | [DeploymentEdition](#deploymentedition) | | Yes |
|
|
| enable_app_deploy | boolean | | Yes |
|
|
| enable_change_email | boolean, <br>**Default:** true | | Yes |
|
|
| enable_collaboration_mode | boolean, <br>**Default:** true | | Yes |
|
|
| enable_creators_platform | boolean | | Yes |
|
|
| enable_email_code_login | boolean | | Yes |
|
|
| enable_email_password_login | boolean, <br>**Default:** true | | Yes |
|
|
| enable_explore_banner | boolean | | Yes |
|
|
| enable_learn_app | boolean, <br>**Default:** true | | Yes |
|
|
| enable_marketplace | boolean | | Yes |
|
|
| enable_social_oauth_login | boolean | | Yes |
|
|
| enable_step_by_step_tour | boolean | | Yes |
|
|
| is_allow_register | boolean | | Yes |
|
|
| is_email_setup | boolean | | Yes |
|
|
| knowledge_fs_enabled | boolean | | Yes |
|
|
| knowledge_fs_upload_enabled | boolean | | Yes |
|
|
| license | [LicenseStatusModel](#licensestatusmodel) | | Yes |
|
|
| plugin_installation_permission | [PluginInstallationPermissionModel](#plugininstallationpermissionmodel) | | Yes |
|
|
| rbac_enabled | boolean | | Yes |
|
|
| sso_enforced_for_signin | boolean | | Yes |
|
|
| sso_enforced_for_signin_protocol | string | | Yes |
|
|
| webapp_auth | [WebAppAuthModel](#webappauthmodel) | | Yes |
|
|
|
|
#### SystemParameters
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| audio_file_size_limit | integer | | Yes |
|
|
| file_size_limit | integer | | Yes |
|
|
| image_file_size_limit | integer | | Yes |
|
|
| video_file_size_limit | integer | | Yes |
|
|
| workflow_file_upload_limit | integer | | Yes |
|
|
|
|
#### Tag
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### TagBasePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | Tag name | Yes |
|
|
| type | [TagType](#tagtype) | | Yes |
|
|
|
|
#### TagBindingPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| tag_ids | [ string ] | Tag IDs to bind | Yes |
|
|
| target_id | string | Target ID to bind tags to | Yes |
|
|
| type | [TagType](#tagtype) | | Yes |
|
|
|
|
#### TagBindingRemovePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| tag_ids | [ string ] | Tag IDs to remove | Yes |
|
|
| target_id | string | Target ID to unbind tag from | Yes |
|
|
| type | [TagType](#tagtype) | | Yes |
|
|
|
|
#### TagListQueryParam
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword | string | Search keyword | No |
|
|
| type | string, <br>**Available values:** "", "app", "knowledge", "snippet" | Tag type filter<br>*Enum:* `""`, `"app"`, `"knowledge"`, `"snippet"` | No |
|
|
|
|
#### TagListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TagListResponse | array | | |
|
|
|
|
#### TagResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| binding_count | string | | No |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | No |
|
|
|
|
#### TagType
|
|
|
|
Tag type
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TagType | string | Tag type | |
|
|
|
|
#### TagUpdateRequestPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | Tag name | Yes |
|
|
|
|
#### TenantAccountRole
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TenantAccountRole | string | | |
|
|
|
|
#### TenantInfoResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| custom_config | [WorkspaceCustomConfigResponse](#workspacecustomconfigresponse) | | No |
|
|
| id | string | | Yes |
|
|
| in_trial | boolean | | No |
|
|
| name | string | | No |
|
|
| next_credit_reset_date | integer | | No |
|
|
| plan | string | | No |
|
|
| role | string | | No |
|
|
| status | string | | No |
|
|
| trial_credits | integer | | No |
|
|
| trial_credits_exhausted_at | integer | | No |
|
|
| trial_credits_used | integer | | No |
|
|
| trial_end_reason | string | | No |
|
|
|
|
#### TenantListItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| current | boolean | | Yes |
|
|
| id | string | | Yes |
|
|
| last_opened_at | integer | | No |
|
|
| name | string | | No |
|
|
| plan | string | | No |
|
|
| status | string | | No |
|
|
|
|
#### TenantListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| workspaces | [ [TenantListItemResponse](#tenantlistitemresponse) ] | | Yes |
|
|
|
|
#### TenantPluginAutoUpgradeCategory
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TenantPluginAutoUpgradeCategory | string | | |
|
|
|
|
#### TenantPluginAutoUpgradeMode
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TenantPluginAutoUpgradeMode | string | | |
|
|
|
|
#### TenantPluginAutoUpgradeStrategySetting
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TenantPluginAutoUpgradeStrategySetting | string | | |
|
|
|
|
#### TenantPluginDebugPermission
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TenantPluginDebugPermission | string | | |
|
|
|
|
#### TenantPluginInstallPermission
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TenantPluginInstallPermission | string | | |
|
|
|
|
#### TextContentResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | Yes |
|
|
|
|
#### TextFileResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TextFileResponse | string | | |
|
|
|
|
#### TextToAudioPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| message_id | string | Message ID. Takes priority over `text` when both are provided. | No |
|
|
| streaming | boolean | Reserved for compatibility; TTS response streaming is determined by the provider output. | No |
|
|
| text | string | Speech content to convert. | No |
|
|
| voice | string | Voice to use for text-to-speech. Available voices depend on the TTS provider configured for this app. Omit to use the app's configured voice when available; that value is exposed by [Get App Parameters](/api-reference/applications/get-app-parameters) as `text_to_speech.voice`. | No |
|
|
|
|
#### TextToSpeechPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| message_id | string | Message ID | No |
|
|
| streaming | boolean | Whether to stream audio | No |
|
|
| text | string | Text to convert | Yes |
|
|
| voice | string | Voice name | No |
|
|
|
|
#### TextToSpeechRequest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| message_id | string | | No |
|
|
| streaming | boolean | | No |
|
|
| text | string | | No |
|
|
| voice | string | | No |
|
|
|
|
#### TextToSpeechVoiceListResponse
|
|
|
|
Available voices
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TextToSpeechVoiceListResponse | array | Available voices | |
|
|
|
|
#### TextToSpeechVoiceQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| language | string | Language code | Yes |
|
|
|
|
#### TextToSpeechVoiceResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | Voice display name | Yes |
|
|
| value | string | Voice identifier | Yes |
|
|
|
|
#### TokensPerSecondStatisticItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| tps | number | | Yes |
|
|
|
|
#### TokensPerSecondStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [TokensPerSecondStatisticItem](#tokenspersecondstatisticitem) ] | | Yes |
|
|
|
|
#### Tool
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | No |
|
|
|
|
#### ToolApiEntity
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| author | string | | Yes |
|
|
| description | [I18nObject](#i18nobject) | | Yes |
|
|
| label | [I18nObject](#i18nobject) | | Yes |
|
|
| labels | [ string ] | | No |
|
|
| name | string | | Yes |
|
|
| output_schema | object | | No |
|
|
| parameters | [ [ToolParameter](#toolparameter) ] | | No |
|
|
|
|
#### ToolApiListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ToolApiListResponse | array | | |
|
|
|
|
#### ToolEmojiIcon
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| background | string | | Yes |
|
|
| content | string | | Yes |
|
|
|
|
#### ToolLabel
|
|
|
|
Tool label
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| icon | string | The icon of the tool | Yes |
|
|
| label | [I18nObject](#i18nobject) | The label of the tool | Yes |
|
|
| name | string | The name of the tool | Yes |
|
|
|
|
#### ToolLabelEnum
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ToolLabelEnum | string | | |
|
|
|
|
#### ToolLabelListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ToolLabelListResponse | array | | |
|
|
|
|
#### ToolOAuthCustomClientPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| client_params | object | | No |
|
|
| enable_oauth_custom_client | boolean | | No |
|
|
|
|
#### ToolParameter
|
|
|
|
Overrides type
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| auto_generate | [PluginParameterAutoGenerate](#pluginparameterautogenerate) | | No |
|
|
| default | number<br>integer<br>string<br>boolean<br>[ object ]<br>object | | No |
|
|
| form | [ToolParameterForm](#toolparameterform) | The form of the parameter, schema/form/llm | Yes |
|
|
| human_description | [I18nObject](#i18nobject) | The description presented to the user | No |
|
|
| input_schema | object | | No |
|
|
| label | [I18nObject](#i18nobject) | The label presented to the user | Yes |
|
|
| llm_description | string | | No |
|
|
| max | number<br>integer | | No |
|
|
| min | number<br>integer | | No |
|
|
| name | string | The name of the parameter | Yes |
|
|
| options | [ [PluginParameterOption](#pluginparameteroption) ] | | No |
|
|
| placeholder | [I18nObject](#i18nobject) | The placeholder presented to the user | No |
|
|
| precision | integer | | No |
|
|
| required | boolean | | No |
|
|
| scope | string | | No |
|
|
| template | [PluginParameterTemplate](#pluginparametertemplate) | | No |
|
|
| type | [ToolParameterType](#toolparametertype) | The type of the parameter | Yes |
|
|
|
|
#### ToolParameterForm
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ToolParameterForm | string | | |
|
|
|
|
#### ToolParameterType
|
|
|
|
removes TOOLS_SELECTOR from PluginParameterType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ToolParameterType | string | removes TOOLS_SELECTOR from PluginParameterType | |
|
|
|
|
#### ToolProviderApiEntityResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allow_delete | boolean, <br>**Default:** true | | No |
|
|
| authentication | [MCPAuthentication](#mcpauthentication) | The OAuth config of the MCP tool | No |
|
|
| author | string | | Yes |
|
|
| configuration | [MCPConfiguration](#mcpconfiguration) | The timeout and sse_read_timeout of the MCP tool | No |
|
|
| description | [I18nObject](#i18nobject) | | Yes |
|
|
| icon | string<br>object | | Yes |
|
|
| icon_dark | string<br>object | | No |
|
|
| id | string | | Yes |
|
|
| identity_mode | string, <br>**Default:** off | Identity-forwarding mechanism: 'off' or 'idp_token' | No |
|
|
| is_dynamic_registration | boolean, <br>**Default:** true | Whether the MCP tool is dynamically registered | No |
|
|
| is_team_authorization | boolean | | No |
|
|
| label | [I18nObject](#i18nobject) | | Yes |
|
|
| labels | [ string ] | | No |
|
|
| masked_headers | object | The masked headers of the MCP tool | No |
|
|
| name | string | | Yes |
|
|
| original_headers | object | The original headers of the MCP tool | No |
|
|
| plugin_id | string | The plugin id of the tool | No |
|
|
| plugin_unique_identifier | string | The unique identifier of the tool | No |
|
|
| server_identifier | string | The server identifier of the MCP tool | No |
|
|
| server_url | string | The server url of the tool | No |
|
|
| team_credentials | object | | No |
|
|
| tools | [ [ToolApiEntity](#toolapientity) ] | | No |
|
|
| type | [ToolProviderType](#toolprovidertype) | | Yes |
|
|
| updated_at | integer | | No |
|
|
| workflow_app_id | string | The app id of the workflow tool | No |
|
|
|
|
#### ToolProviderCredentialApiEntity
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_by | string | User ID of the credential creator | No |
|
|
| credential_type | [CredentialType](#credentialtype) | The type of the credential | Yes |
|
|
| credentials | object | The credentials of the provider | No |
|
|
| from_other_member | boolean | True when this credential is being returned only because a workflow/agent node still references it but it would normally be hidden from this user by the visibility filter (another member's only_me credential). The frontend renders it as 'borrowed' — selectable until the node switches away, but not editable/deletable. | No |
|
|
| id | string | The unique id of the credential | Yes |
|
|
| is_default | boolean | Whether the credential is the default credential for the provider in the workspace | No |
|
|
| name | string | The name of the credential | Yes |
|
|
| partial_member_list | [ string ] | List of user IDs allowed when visibility is partial_members | No |
|
|
| provider | string | The provider of the credential | Yes |
|
|
| visibility | string, <br>**Default:** all_team_members | Credential visibility: only_me, all_team_members, or partial_members | No |
|
|
|
|
#### ToolProviderCredentialInfoApiEntity
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | [ [ToolProviderCredentialApiEntity](#toolprovidercredentialapientity) ] | The credentials of the provider | Yes |
|
|
| is_oauth_custom_client_enabled | boolean | Whether the OAuth custom client is enabled for the provider | No |
|
|
| supported_credential_types | [ [CredentialType](#credentialtype) ] | The supported credential types of the provider | Yes |
|
|
|
|
#### ToolProviderCredentialListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ToolProviderCredentialListResponse | array | | |
|
|
|
|
#### ToolProviderEntity
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials_schema | [ [ProviderConfig](#providerconfig) ] | | No |
|
|
| identity | [ToolProviderIdentity](#toolprovideridentity) | | Yes |
|
|
| oauth_schema | [OAuthSchema](#oauthschema) | | No |
|
|
| plugin_id | string | | No |
|
|
|
|
#### ToolProviderIdentity
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| author | string | The author of the tool | Yes |
|
|
| description | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | The description of the tool | Yes |
|
|
| icon | string | The icon of the tool | Yes |
|
|
| icon_dark | string | The dark icon of the tool | No |
|
|
| label | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | The label of the tool | Yes |
|
|
| name | string | The name of the tool | Yes |
|
|
| tags | [ [ToolLabelEnum](#toollabelenum) ] | The tags of the tool | No |
|
|
|
|
#### ToolProviderListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| type | string | | No |
|
|
|
|
#### ToolProviderListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ToolProviderListResponse | array | | |
|
|
|
|
#### ToolProviderType
|
|
|
|
Enum class for tool provider
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ToolProviderType | string | Enum class for tool provider | |
|
|
|
|
#### ToolSelectorScope
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ToolSelectorScope | string | | |
|
|
|
|
#### TraceAppConfigResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string | | No |
|
|
| created_at | string | | No |
|
|
| error | string | | No |
|
|
| has_not_configured | boolean | | No |
|
|
| id | string | | No |
|
|
| is_active | boolean | | No |
|
|
| result | string | | No |
|
|
| tracing_config | object | | No |
|
|
| tracing_provider | string | | No |
|
|
| updated_at | string | | No |
|
|
|
|
#### TraceConfigPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| tracing_config | object | Tracing configuration data | Yes |
|
|
| tracing_provider | string | Tracing provider name | Yes |
|
|
|
|
#### TraceProviderQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| tracing_provider | string | Tracing provider name | Yes |
|
|
|
|
#### TrialAppAgentMode
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | No |
|
|
| strategy | string | | No |
|
|
| tools | [ [JsonObject](#jsonobject) ] | | No |
|
|
|
|
#### TrialAppDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_mode | string | | No |
|
|
| api_base_url | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| deleted_tools | [ [TrialDeletedToolResponse](#trialdeletedtoolresponse) ] | | No |
|
|
| description | string | | No |
|
|
| enable_api | boolean | | Yes |
|
|
| enable_site | boolean | | Yes |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | [TrialIconType](#trialicontype) | | No |
|
|
| icon_url | string | | No |
|
|
| id | string | | Yes |
|
|
| max_active_requests | integer | | No |
|
|
| mode | [TrialAppMode](#trialappmode) | | Yes |
|
|
| model_config | [TrialAppModelConfigResponse](#trialappmodelconfigresponse) | | No |
|
|
| name | string | | Yes |
|
|
| permission_keys | [ string ] | | No |
|
|
| site | [TrialSiteResponse](#trialsiteresponse) | | Yes |
|
|
| tags | [ [TrialTagResponse](#trialtagresponse) ] | | No |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
| use_icon_as_answer_icon | boolean | | No |
|
|
| workflow | [TrialWorkflowPartialResponse](#trialworkflowpartialresponse) | | No |
|
|
|
|
#### TrialAppMode
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TrialAppMode | string | | |
|
|
|
|
#### TrialAppModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| completion_params | [JsonObject](#jsonobject) | | No |
|
|
| mode | string | | No |
|
|
| name | string | | Yes |
|
|
| provider | string | | Yes |
|
|
|
|
#### TrialAppModelConfigResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_mode | [TrialAppAgentMode](#trialappagentmode) | | No |
|
|
| annotation_reply | [JsonObject](#jsonobject) | | No |
|
|
| chat_prompt_config | [JsonObject](#jsonobject) | | No |
|
|
| completion_prompt_config | [JsonObject](#jsonobject) | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| dataset_configs | [JsonObject](#jsonobject) | | No |
|
|
| dataset_query_variable | string | | No |
|
|
| external_data_tools | [ [JsonObject](#jsonobject) ] | | No |
|
|
| file_upload | [JsonObject](#jsonobject) | | No |
|
|
| model | [TrialAppModel](#trialappmodel) | | No |
|
|
| more_like_this | [JsonObject](#jsonobject) | | No |
|
|
| opening_statement | string | | No |
|
|
| pre_prompt | string | | No |
|
|
| prompt_type | string | | No |
|
|
| retriever_resource | [JsonObject](#jsonobject) | | No |
|
|
| sensitive_word_avoidance | [JsonObject](#jsonobject) | | No |
|
|
| speech_to_text | [JsonObject](#jsonobject) | | No |
|
|
| suggested_questions | [ string ] | | No |
|
|
| suggested_questions_after_answer | [JsonObject](#jsonobject) | | No |
|
|
| text_to_speech | [JsonObject](#jsonobject) | | No |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
| user_input_form | [ [JsonObject](#jsonobject) ] | | No |
|
|
|
|
#### TrialDatasetListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ids | [ string ] | Dataset IDs | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of items per page | No |
|
|
| page | integer, <br>**Default:** 1 | Page number | No |
|
|
|
|
#### TrialDatasetListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [TrialDatasetResponse](#trialdatasetresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### TrialDatasetResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| data_source_type | string | | No |
|
|
| description | string | | No |
|
|
| id | string | | Yes |
|
|
| indexing_technique | string | | No |
|
|
| name | string | | Yes |
|
|
| permission | string | | No |
|
|
| permission_keys | [ string ] | | No |
|
|
|
|
#### TrialDeletedToolResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| provider_id | string | | Yes |
|
|
| tool_name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### TrialIconType
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TrialIconType | string | | |
|
|
|
|
#### TrialModelsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| trial_models | [ string ] | | Yes |
|
|
|
|
#### TrialSimpleAccount
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | No |
|
|
| id | string | | Yes |
|
|
| name | string | | No |
|
|
|
|
#### TrialSiteResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| access_token | string | | No |
|
|
| app_base_url | string | | No |
|
|
| chat_color_theme | string | | No |
|
|
| chat_color_theme_inverted | boolean | | No |
|
|
| code | string | | No |
|
|
| copyright | string | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| custom_disclaimer | string | | No |
|
|
| customize_domain | string | | No |
|
|
| customize_token_strategy | string | | No |
|
|
| default_language | string | | Yes |
|
|
| description | string | | No |
|
|
| icon | string | | No |
|
|
| icon_background | string | | No |
|
|
| icon_type | [TrialIconType](#trialicontype) | | No |
|
|
| icon_url | string | | No |
|
|
| input_placeholder | string | | No |
|
|
| privacy_policy | string | | No |
|
|
| prompt_public | boolean | | No |
|
|
| show_workflow_steps | boolean | | No |
|
|
| title | string | | Yes |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
| use_icon_as_answer_icon | boolean | | No |
|
|
|
|
#### TrialTagResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### TrialWorkflowPartialResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| id | string | | Yes |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
|
|
#### TrialWorkflowResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_variables | [ [WorkflowConversationVariableResponse](#workflowconversationvariableresponse) ] | | No |
|
|
| created_at | integer | | No |
|
|
| created_by | [TrialSimpleAccount](#trialsimpleaccount) | | No |
|
|
| environment_variables | [ [JsonObject](#jsonobject) ] | | No |
|
|
| features | [JsonObject](#jsonobject) | | No |
|
|
| graph | [JsonObject](#jsonobject) | | Yes |
|
|
| hash | string | | No |
|
|
| id | string | | Yes |
|
|
| marked_comment | string | | No |
|
|
| marked_name | string | | No |
|
|
| rag_pipeline_variables | [ [JsonObject](#jsonobject) ] | | No |
|
|
| tool_published | boolean | | No |
|
|
| updated_at | integer | | No |
|
|
| updated_by | [TrialSimpleAccount](#trialsimpleaccount) | | No |
|
|
| version | string | | No |
|
|
|
|
#### TriggerCreationMethod
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TriggerCreationMethod | string | | |
|
|
|
|
#### TriggerOAuthAuthorizeResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| authorization_url | string | | Yes |
|
|
| subscription_builder | [SubscriptionBuilderApiEntity](#subscriptionbuilderapientity) | | Yes |
|
|
| subscription_builder_id | string | | Yes |
|
|
|
|
#### TriggerOAuthClientPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| client_params | object | | No |
|
|
| enabled | boolean | | No |
|
|
|
|
#### TriggerOAuthClientResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| configured | boolean | | Yes |
|
|
| custom_configured | boolean | | Yes |
|
|
| custom_enabled | boolean | | Yes |
|
|
| oauth_client_schema | [ [ProviderConfig](#providerconfig) ] | | Yes |
|
|
| params | object | | Yes |
|
|
| redirect_uri | string | | Yes |
|
|
| system_configured | boolean | | Yes |
|
|
|
|
#### TriggerProviderApiEntity
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| author | string | The author of the trigger provider | Yes |
|
|
| description | [I18nObject](#i18nobject) | The description of the trigger provider | Yes |
|
|
| events | [ [EventApiEntity](#eventapientity) ] | The events of the trigger provider | Yes |
|
|
| icon | string | The icon of the trigger provider | No |
|
|
| icon_dark | string | The dark icon of the trigger provider | No |
|
|
| label | [I18nObject](#i18nobject) | The label of the trigger provider | Yes |
|
|
| name | string | The name of the trigger provider | Yes |
|
|
| plugin_id | string | The plugin id of the tool | No |
|
|
| plugin_unique_identifier | string | The unique identifier of the tool | No |
|
|
| subscription_constructor | [SubscriptionConstructor](#subscriptionconstructor) | The subscription constructor of the trigger provider | No |
|
|
| subscription_schema | [ [ProviderConfig](#providerconfig) ] | The subscription schema of the trigger provider | No |
|
|
| supported_creation_methods | [ [TriggerCreationMethod](#triggercreationmethod) ] | Supported creation methods for the trigger provider. like 'OAUTH', 'APIKEY', 'MANUAL'. | No |
|
|
| tags | [ string ] | The tags of the trigger provider | No |
|
|
|
|
#### TriggerProviderEntity
|
|
|
|
The configuration of a trigger provider
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| events | [ [EventEntity](#evententity) ] | The events of the trigger provider | No |
|
|
| identity | [TriggerProviderIdentity](#triggerprovideridentity) | | Yes |
|
|
| subscription_constructor | [SubscriptionConstructor](#subscriptionconstructor) | The subscription constructor of the trigger provider | No |
|
|
| subscription_schema | [ [ProviderConfig](#providerconfig) ] | The configuration schema stored in the subscription entity | No |
|
|
|
|
#### TriggerProviderErrorResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| error | string | | Yes |
|
|
|
|
#### TriggerProviderIdentity
|
|
|
|
The identity of the trigger provider
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| author | string | The author of the trigger provider | Yes |
|
|
| description | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | The description of the trigger provider | Yes |
|
|
| icon | string | The icon of the trigger provider | No |
|
|
| icon_dark | string | The dark icon of the trigger provider | No |
|
|
| label | [core__tools__entities__common_entities__I18nObject](#core__tools__entities__common_entities__i18nobject) | The label of the trigger provider | Yes |
|
|
| name | string | The name of the trigger provider | Yes |
|
|
| tags | [ string ] | The tags of the trigger provider | No |
|
|
|
|
#### TriggerProviderListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TriggerProviderListResponse | array | | |
|
|
|
|
#### TriggerProviderSubscriptionApiEntity
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_type | [CredentialType](#credentialtype) | The type of the credential | Yes |
|
|
| credentials | object | The credentials of the subscription | Yes |
|
|
| endpoint | string | The endpoint of the subscription | Yes |
|
|
| id | string | The unique id of the subscription | Yes |
|
|
| name | string | The name of the subscription | Yes |
|
|
| parameters | object | The parameters of the subscription | Yes |
|
|
| properties | object | The properties of the subscription | Yes |
|
|
| provider | string | The provider id of the subscription | Yes |
|
|
| workflows_in_use | integer | The number of workflows using this subscription | Yes |
|
|
|
|
#### TriggerProviderSubscriptionListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| TriggerProviderSubscriptionListResponse | array | | |
|
|
|
|
#### TriggerSubscriptionBuilderCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credential_type | string, <br>**Default:** unauthorized | | No |
|
|
|
|
#### TriggerSubscriptionBuilderCreateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| subscription_builder | [SubscriptionBuilderApiEntity](#subscriptionbuilderapientity) | | Yes |
|
|
|
|
#### TriggerSubscriptionBuilderLogsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| logs | [ [RequestLog](#requestlog) ] | | Yes |
|
|
|
|
#### TriggerSubscriptionBuilderUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | object | | No |
|
|
| name | string | | No |
|
|
| parameters | object | | No |
|
|
| properties | object | | No |
|
|
|
|
#### TriggerSubscriptionBuilderVerifyPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| credentials | object | | Yes |
|
|
|
|
#### TriggerVerificationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| verified | boolean | | Yes |
|
|
|
|
#### UnaddedModelConfiguration
|
|
|
|
Model class for provider unadded model configuration.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| model | string | | Yes |
|
|
| model_type | [ModelType](#modeltype) | | Yes |
|
|
|
|
#### UpdateAnnotationPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| annotation_reply | object | | No |
|
|
| answer | string | | No |
|
|
| content | string | | No |
|
|
| question | string | | No |
|
|
|
|
#### UpdateAppPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | App description (max 400 chars) | No |
|
|
| icon | string | Icon | No |
|
|
| icon_background | string | Icon background color | No |
|
|
| icon_type | [IconType](#icontype) | Icon type | No |
|
|
| max_active_requests | integer | Maximum active requests | No |
|
|
| name | string | App name | Yes |
|
|
| use_icon_as_answer_icon | boolean | Use icon as answer icon | No |
|
|
|
|
#### UpdateSnippetPayload
|
|
|
|
Payload for updating a snippet.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| icon_info | [IconInfo](#iconinfo) | | No |
|
|
| name | string | | No |
|
|
|
|
#### UploadConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| attachment_image_file_size_limit | integer | | Yes |
|
|
| audio_file_size_limit | integer | | Yes |
|
|
| batch_count_limit | integer | | Yes |
|
|
| file_size_limit | integer | | Yes |
|
|
| file_upload_limit | integer | | Yes |
|
|
| image_file_batch_limit | integer | | Yes |
|
|
| image_file_size_limit | integer | | Yes |
|
|
| single_chunk_attachment_limit | integer | | Yes |
|
|
| video_file_size_limit | integer | | Yes |
|
|
| workflow_file_upload_limit | integer | | Yes |
|
|
|
|
#### UrlQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| url | string (uri) | | Yes |
|
|
|
|
#### UrlResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| url | string | | Yes |
|
|
|
|
#### UsageCheckResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| is_using | boolean | | Yes |
|
|
|
|
#### UsageCountResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| count | integer | | Yes |
|
|
| is_using | boolean | | Yes |
|
|
|
|
#### UserActionConfig
|
|
|
|
User action configuration.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| button_style | [ButtonStyle](#buttonstyle) | | No |
|
|
| id | string | | Yes |
|
|
| title | string | | Yes |
|
|
|
|
#### UserSatisfactionRateStatisticItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| rate | number | | Yes |
|
|
|
|
#### UserSatisfactionRateStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [UserSatisfactionRateStatisticItem](#usersatisfactionratestatisticitem) ] | | Yes |
|
|
|
|
#### ValidationResultResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| error | string | | No |
|
|
| result | string, <br>**Available values:** "error", "success" | *Enum:* `"error"`, `"success"` | Yes |
|
|
|
|
#### ValueSourceType
|
|
|
|
ValueSourceType records whether the value comes from a static setting
|
|
in form definition, or a variable while the workflow is running.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| ValueSourceType | string | ValueSourceType records whether the value comes from a static setting in form definition, or a variable while the workflow is running. | |
|
|
|
|
#### VerificationTokenResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | | Yes |
|
|
| is_valid | boolean | | Yes |
|
|
| token | string | | Yes |
|
|
|
|
#### WebAppAuthModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allow_email_code_login | boolean | | Yes |
|
|
| allow_email_password_login | boolean | | Yes |
|
|
| allow_public_access | boolean, <br>**Default:** true | | Yes |
|
|
| allow_sso | boolean | | Yes |
|
|
| enabled | boolean | | Yes |
|
|
| sso_config | [WebAppAuthSSOModel](#webappauthssomodel) | | Yes |
|
|
|
|
#### WebAppAuthSSOModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| protocol | string | | Yes |
|
|
|
|
#### WebhookTriggerResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | string | | No |
|
|
| id | string | | Yes |
|
|
| node_id | string | | Yes |
|
|
| webhook_debug_url | string | | Yes |
|
|
| webhook_id | string | | Yes |
|
|
| webhook_url | string | | Yes |
|
|
|
|
#### WebsiteCrawlPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| options | object | | Yes |
|
|
| provider | string, <br>**Available values:** "firecrawl", "jinareader", "watercrawl" | *Enum:* `"firecrawl"`, `"jinareader"`, `"watercrawl"` | Yes |
|
|
| url | string | | Yes |
|
|
|
|
#### WebsiteCrawlResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| WebsiteCrawlResponse | object | | |
|
|
|
|
#### WebsiteCrawlStatusQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| provider | string, <br>**Available values:** "firecrawl", "jinareader", "watercrawl" | *Enum:* `"firecrawl"`, `"jinareader"`, `"watercrawl"` | Yes |
|
|
|
|
#### WebsiteInfo
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| job_id | string | | Yes |
|
|
| only_main_content | boolean, <br>**Default:** true | | No |
|
|
| provider | string | | Yes |
|
|
| urls | [ string ] | | Yes |
|
|
|
|
#### WeightKeywordSetting
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword_weight | number | Weight assigned to keyword search results. | Yes |
|
|
|
|
#### WeightModel
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| keyword_setting | [WeightKeywordSetting](#weightkeywordsetting) | Keyword search weight settings. | No |
|
|
| vector_setting | [WeightVectorSetting](#weightvectorsetting) | Semantic search weight settings. | No |
|
|
| weight_type | string | Strategy for balancing semantic and keyword search weights. | No |
|
|
|
|
#### WeightVectorSetting
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| embedding_model_name | string | Name of the embedding model used for vector search. | Yes |
|
|
| embedding_provider_name | string | Provider of the embedding model used for vector search. | Yes |
|
|
| vector_weight | number | Weight assigned to semantic vector search results. | Yes |
|
|
|
|
#### WorkflowAgentBindingType
|
|
|
|
How a workflow node is bound to an Agent.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| WorkflowAgentBindingType | string | How a workflow node is bound to an Agent. | |
|
|
|
|
#### WorkflowAgentComposerQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| snapshot_id | string | | No |
|
|
|
|
#### WorkflowAgentComposerResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| active_config_snapshot | [AgentConfigSnapshotSummaryResponse](#agentconfigsnapshotsummaryresponse) | | No |
|
|
| agent | [AgentComposerAgentResponse](#agentcomposeragentresponse) | | No |
|
|
| agent_soul | [AgentSoulConfig](#agentsoulconfig) | | Yes |
|
|
| app_id | string | | No |
|
|
| backing_app_id | string | | No |
|
|
| binding | [AgentComposerBindingResponse](#agentcomposerbindingresponse) | | No |
|
|
| chat_endpoint | string | | No |
|
|
| debug_conversation_has_messages | boolean | | No |
|
|
| debug_conversation_id | string | | No |
|
|
| debug_conversation_message_count | integer | | No |
|
|
| effective_declared_outputs | [ [DeclaredOutputConfig](#declaredoutputconfig) ] | | No |
|
|
| hidden_app_backed | boolean | | No |
|
|
| impact_summary | [AgentComposerImpactResponse](#agentcomposerimpactresponse) | | No |
|
|
| node_id | string | | No |
|
|
| node_job | [WorkflowNodeJobConfig](#workflownodejobconfig) | | Yes |
|
|
| save_options | [ [ComposerSaveStrategy](#composersavestrategy) ] | | Yes |
|
|
| soul_lock | [AgentComposerSoulLockResponse](#agentcomposersoullockresponse) | | Yes |
|
|
| validation | [ComposerValidationFindingsResponse](#composervalidationfindingsresponse) | | No |
|
|
| variant | string | | Yes |
|
|
| workflow_id | string | | No |
|
|
|
|
#### WorkflowAgentSandboxUploadPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| node_execution_id | string | Optional workflow node execution ID. When omitted, the latest active session for the node is used. | No |
|
|
| path | string | File path relative to the sandbox workspace | Yes |
|
|
|
|
#### WorkflowAppLogPaginationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [WorkflowAppLogPartialResponse](#workflowapplogpartialresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### WorkflowAppLogPartialResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| created_by_account | [SimpleAccountResponse](#simpleaccountresponse) | | No |
|
|
| created_by_end_user | [SimpleEndUser](#simpleenduser) | | No |
|
|
| created_by_role | string | | No |
|
|
| created_from | string | | No |
|
|
| details | | | No |
|
|
| id | string | | Yes |
|
|
| workflow_run | [WorkflowRunForLogResponse](#workflowrunforlogresponse) | | No |
|
|
|
|
#### WorkflowAppLogQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at__after | string | Filter logs created after this timestamp | No |
|
|
| created_at__before | string | Filter logs created before this timestamp | No |
|
|
| created_by_account | string | Filter by account | No |
|
|
| created_by_end_user_session_id | string | Filter by end user session ID | No |
|
|
| detail | boolean | Whether to return detailed logs | No |
|
|
| keyword | string | Search keyword for filtering logs | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of items per page (1-100) | No |
|
|
| page | integer, <br>**Default:** 1 | Page number (1-99999) | No |
|
|
| status | [WorkflowExecutionStatus](#workflowexecutionstatus) | Execution status filter (succeeded, failed, stopped, partial-succeeded) | No |
|
|
|
|
#### WorkflowArchivedLogPaginationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [WorkflowArchivedLogPartialResponse](#workflowarchivedlogpartialresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### WorkflowArchivedLogPartialResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| created_by_account | [SimpleAccountResponse](#simpleaccountresponse) | | No |
|
|
| created_by_end_user | [SimpleEndUser](#simpleenduser) | | No |
|
|
| id | string | | Yes |
|
|
| trigger_metadata | | | No |
|
|
| workflow_run | [WorkflowRunForArchivedLogResponse](#workflowrunforarchivedlogresponse) | | No |
|
|
|
|
#### WorkflowAverageAppInteractionStatisticItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| interactions | number | | Yes |
|
|
|
|
#### WorkflowAverageAppInteractionStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [WorkflowAverageAppInteractionStatisticItem](#workflowaverageappinteractionstatisticitem) ] | | Yes |
|
|
|
|
#### WorkflowCommentAccount
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| avatar_url | string | | Yes |
|
|
| email | string | | Yes |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
|
|
#### WorkflowCommentBasic
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | Yes |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | Yes |
|
|
| created_by_account | [WorkflowCommentAccount](#workflowcommentaccount) | | No |
|
|
| id | string | | Yes |
|
|
| mention_count | integer | | Yes |
|
|
| participants | [ [WorkflowCommentAccount](#workflowcommentaccount) ] | | Yes |
|
|
| position_x | number | | Yes |
|
|
| position_y | number | | Yes |
|
|
| reply_count | integer | | Yes |
|
|
| resolved | boolean | | Yes |
|
|
| resolved_at | integer | | No |
|
|
| resolved_by | string | | No |
|
|
| resolved_by_account | [WorkflowCommentAccount](#workflowcommentaccount) | | No |
|
|
| updated_at | integer | | No |
|
|
|
|
#### WorkflowCommentBasicList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [WorkflowCommentBasic](#workflowcommentbasic) ] | | Yes |
|
|
|
|
#### WorkflowCommentCreate
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| id | string | | Yes |
|
|
|
|
#### WorkflowCommentCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | Comment content | Yes |
|
|
| mentioned_user_ids | [ string ] | Mentioned user IDs | No |
|
|
| position_x | number | Comment X position | Yes |
|
|
| position_y | number | Comment Y position | Yes |
|
|
|
|
#### WorkflowCommentDetail
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | Yes |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | Yes |
|
|
| created_by_account | [WorkflowCommentAccount](#workflowcommentaccount) | | No |
|
|
| id | string | | Yes |
|
|
| mentions | [ [WorkflowCommentMention](#workflowcommentmention) ] | | Yes |
|
|
| position_x | number | | Yes |
|
|
| position_y | number | | Yes |
|
|
| replies | [ [WorkflowCommentReply](#workflowcommentreply) ] | | Yes |
|
|
| resolved | boolean | | Yes |
|
|
| resolved_at | integer | | No |
|
|
| resolved_by | string | | No |
|
|
| resolved_by_account | [WorkflowCommentAccount](#workflowcommentaccount) | | No |
|
|
| updated_at | integer | | No |
|
|
|
|
#### WorkflowCommentMention
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| mentioned_user_account | [WorkflowCommentAccount](#workflowcommentaccount) | | No |
|
|
| mentioned_user_id | string | | Yes |
|
|
| reply_id | string | | No |
|
|
|
|
#### WorkflowCommentMentionUsersPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| users | [ [AccountWithRoleResponse](#accountwithroleresponse) ] | | Yes |
|
|
|
|
#### WorkflowCommentReply
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | | Yes |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | Yes |
|
|
| created_by_account | [WorkflowCommentAccount](#workflowcommentaccount) | | No |
|
|
| id | string | | Yes |
|
|
|
|
#### WorkflowCommentReplyCreate
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| id | string | | Yes |
|
|
|
|
#### WorkflowCommentReplyPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | Reply content | Yes |
|
|
| mentioned_user_ids | [ string ] | Mentioned user IDs | No |
|
|
|
|
#### WorkflowCommentReplyUpdate
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| updated_at | integer | | No |
|
|
|
|
#### WorkflowCommentResolve
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| resolved | boolean | | Yes |
|
|
| resolved_at | integer | | No |
|
|
| resolved_by | string | | No |
|
|
|
|
#### WorkflowCommentUpdate
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| updated_at | integer | | No |
|
|
|
|
#### WorkflowCommentUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| content | string | Comment content | Yes |
|
|
| mentioned_user_ids | [ string ] | Mentioned user IDs. Omit to keep existing mentions. | No |
|
|
| position_x | number | Comment X position | No |
|
|
| position_y | number | Comment Y position | No |
|
|
|
|
#### WorkflowComposerCopyFromRosterPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| idempotency_key | string | | No |
|
|
| source_agent_id | string | | Yes |
|
|
| source_snapshot_id | string | | No |
|
|
|
|
#### WorkflowConversationVariableResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | Yes |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| value | | | Yes |
|
|
| value_type | string | | Yes |
|
|
|
|
#### WorkflowDailyRunsStatisticItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| runs | integer | | Yes |
|
|
|
|
#### WorkflowDailyRunsStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [WorkflowDailyRunsStatisticItem](#workflowdailyrunsstatisticitem) ] | | Yes |
|
|
|
|
#### WorkflowDailyTerminalsStatisticItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| terminal_count | integer | | Yes |
|
|
|
|
#### WorkflowDailyTerminalsStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [WorkflowDailyTerminalsStatisticItem](#workflowdailyterminalsstatisticitem) ] | | Yes |
|
|
|
|
#### WorkflowDailyTokenCostStatisticItem
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| date | string | | Yes |
|
|
| token_count | integer | | Yes |
|
|
|
|
#### WorkflowDailyTokenCostStatisticResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [WorkflowDailyTokenCostStatisticItem](#workflowdailytokencoststatisticitem) ] | | Yes |
|
|
|
|
#### WorkflowDraftEnvVariable
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| edited | boolean | | No |
|
|
| id | string | | No |
|
|
| name | string | | No |
|
|
| selector | [ string ] | | No |
|
|
| type | string | | No |
|
|
| value_type | string | | No |
|
|
| visible | boolean | | No |
|
|
|
|
#### WorkflowDraftEnvVariableList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [WorkflowDraftEnvVariable](#workflowdraftenvvariable) ] | | No |
|
|
|
|
#### WorkflowDraftVariable
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| edited | boolean | | No |
|
|
| full_content | object | | No |
|
|
| id | string | | No |
|
|
| is_truncated | boolean | | No |
|
|
| name | string | | No |
|
|
| selector | [ string ] | | No |
|
|
| type | string | | No |
|
|
| value | string<br>integer<br>number<br>boolean<br>object<br>[ object ] | | No |
|
|
| value_type | string | | No |
|
|
| visible | boolean | | No |
|
|
|
|
#### WorkflowDraftVariableList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [WorkflowDraftVariable](#workflowdraftvariable) ] | | No |
|
|
|
|
#### WorkflowDraftVariableListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| limit | integer, <br>**Default:** 20 | Items per page | No |
|
|
| page | integer, <br>**Default:** 1 | Page number | No |
|
|
|
|
#### WorkflowDraftVariableListWithoutValue
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [WorkflowDraftVariableWithoutValue](#workflowdraftvariablewithoutvalue) ] | | No |
|
|
| total | integer | | No |
|
|
|
|
#### WorkflowDraftVariablePatchPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | | No |
|
|
| value | | | No |
|
|
|
|
#### WorkflowDraftVariableUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | Variable name | No |
|
|
| value | | Variable value | No |
|
|
|
|
#### WorkflowDraftVariableWithoutValue
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | No |
|
|
| edited | boolean | | No |
|
|
| id | string | | No |
|
|
| is_truncated | boolean | | No |
|
|
| name | string | | No |
|
|
| selector | [ string ] | | No |
|
|
| type | string | | No |
|
|
| value_type | string | | No |
|
|
| visible | boolean | | No |
|
|
|
|
#### WorkflowEnvironmentVariableResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | Yes |
|
|
| id | string | | Yes |
|
|
| name | string | | Yes |
|
|
| value | | | Yes |
|
|
| value_type | string | | Yes |
|
|
|
|
#### WorkflowExecutionStatus
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| WorkflowExecutionStatus | string | | |
|
|
|
|
#### WorkflowFeatureTogglePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | No |
|
|
|
|
#### WorkflowFeaturesConfigPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| file_upload | [WorkflowFileUploadPayload](#workflowfileuploadpayload) | | No |
|
|
| opening_statement | string | | No |
|
|
| retriever_resource | [WorkflowFeatureTogglePayload](#workflowfeaturetogglepayload) | | No |
|
|
| sensitive_word_avoidance | [WorkflowSensitiveWordAvoidancePayload](#workflowsensitivewordavoidancepayload) | | No |
|
|
| speech_to_text | [WorkflowFeatureTogglePayload](#workflowfeaturetogglepayload) | | No |
|
|
| suggested_questions | [ string ] | | No |
|
|
| suggested_questions_after_answer | [WorkflowSuggestedQuestionsAfterAnswerPayload](#workflowsuggestedquestionsafteranswerpayload) | | No |
|
|
| text_to_speech | [WorkflowTextToSpeechPayload](#workflowtexttospeechpayload) | | No |
|
|
|
|
#### WorkflowFeaturesPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| features | [WorkflowFeaturesConfigPayload](#workflowfeaturesconfigpayload) | Workflow feature configuration | Yes |
|
|
|
|
#### WorkflowFileUploadImagePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| detail | string | | No |
|
|
| enabled | boolean | | No |
|
|
| number_limits | integer | | No |
|
|
| transfer_methods | [ string ] | | No |
|
|
|
|
#### WorkflowFileUploadPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allowed_file_extensions | [ string ] | | No |
|
|
| allowed_file_types | [ string ] | | No |
|
|
| allowed_file_upload_methods | [ string ] | | No |
|
|
| audio | [WorkflowFileUploadTransferPayload](#workflowfileuploadtransferpayload) | | No |
|
|
| custom | [WorkflowFileUploadTransferPayload](#workflowfileuploadtransferpayload) | | No |
|
|
| document | [WorkflowFileUploadTransferPayload](#workflowfileuploadtransferpayload) | | No |
|
|
| enabled | boolean | | No |
|
|
| fileUploadConfig | object | | No |
|
|
| image | [WorkflowFileUploadImagePayload](#workflowfileuploadimagepayload) | | No |
|
|
| number_limits | integer | | No |
|
|
| preview_config | [WorkflowFileUploadPreviewConfigPayload](#workflowfileuploadpreviewconfigpayload) | | No |
|
|
| video | [WorkflowFileUploadTransferPayload](#workflowfileuploadtransferpayload) | | No |
|
|
|
|
#### WorkflowFileUploadPreviewConfigPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| file_type_list | [ string ] | | No |
|
|
| mode | string | | No |
|
|
|
|
#### WorkflowFileUploadTransferPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | No |
|
|
| number_limits | integer | | No |
|
|
| transfer_methods | [ string ] | | No |
|
|
|
|
#### WorkflowGenerateErrorCode
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| WorkflowGenerateErrorCode | string | | |
|
|
|
|
#### WorkflowGenerateErrorResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| code | [WorkflowGenerateErrorCode](#workflowgenerateerrorcode) | | Yes |
|
|
| detail | string | | Yes |
|
|
| node_id | string | | No |
|
|
|
|
#### WorkflowGeneratePayload
|
|
|
|
Payload for the cmd+k `/create` and `/refine` workflow generator endpoint.
|
|
|
|
See ``services/workflow_generator_service.py`` for behaviour. Errors are
|
|
surfaced through the same envelope as ``/rule-generate`` so the frontend
|
|
can reuse its existing handler.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| current_graph | [WorkflowGraph](#workflowgraph) | Existing draft graph to refine (cmd+k `/refine`); omit for create-from-scratch | No |
|
|
| ideal_output | string | Optional sample output for grounding | No |
|
|
| instruction | string | Natural-language workflow description | Yes |
|
|
| mode | string, <br>**Available values:** "advanced-chat", "auto", "workflow" | Target app mode for the generated graph; 'auto' lets the backend classify the instruction<br>*Enum:* `"advanced-chat"`, `"auto"`, `"workflow"` | Yes |
|
|
| model_config | [ModelConfig](#modelconfig) | Model configuration | Yes |
|
|
|
|
#### WorkflowGeneratePlanEventResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_name | string | | No |
|
|
| description | string | | No |
|
|
| event | string | | No |
|
|
| icon | string | | No |
|
|
| mode | string | *Enum:* `"advanced-chat"`, `"workflow"` | Yes |
|
|
| nodes | [ [WorkflowPlanNodeResponse](#workflowplannoderesponse) ] | | Yes |
|
|
| start_inputs | [ [WorkflowPlanStartInputResponse](#workflowplanstartinputresponse) ] | | No |
|
|
| title | string | | No |
|
|
|
|
#### WorkflowGenerateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_name | string | | No |
|
|
| error | string | | No |
|
|
| errors | [ [WorkflowGenerateErrorResponse](#workflowgenerateerrorresponse) ] | | No |
|
|
| graph | [WorkflowGraph](#workflowgraph) | | Yes |
|
|
| icon | string | | No |
|
|
| message | string | | No |
|
|
| mode | string | | No |
|
|
|
|
#### WorkflowGenerateResultEventResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_name | string | | No |
|
|
| error | string | | No |
|
|
| errors | [ [WorkflowGenerateErrorResponse](#workflowgenerateerrorresponse) ] | | No |
|
|
| event | string | | No |
|
|
| graph | [WorkflowGraph](#workflowgraph) | | Yes |
|
|
| icon | string | | No |
|
|
| message | string | | No |
|
|
| mode | string | | No |
|
|
|
|
#### WorkflowGenerateStreamEventResponse
|
|
|
|
Schema for each JSON object carried by an SSE ``data:`` frame.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| WorkflowGenerateStreamEventResponse | [WorkflowGeneratePlanEventResponse](#workflowgenerateplaneventresponse)<br>[WorkflowGenerateResultEventResponse](#workflowgenerateresulteventresponse) | Schema for each JSON object carried by an SSE ``data:`` frame. | |
|
|
|
|
#### WorkflowGraph
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| edges | [ [WorkflowGraphEdge](#workflowgraphedge) ] | | Yes |
|
|
| nodes | [ [WorkflowGraphNode](#workflowgraphnode) ] | | Yes |
|
|
| viewport | [WorkflowGraphViewport](#workflowgraphviewport) | | Yes |
|
|
|
|
#### WorkflowGraphEdge
|
|
|
|
React Flow edge shape with extensible renderer metadata.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
| source | string | | Yes |
|
|
| target | string | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### WorkflowGraphNode
|
|
|
|
React Flow node shape accepted and returned by the generator.
|
|
|
|
Node-specific configuration lives under ``data`` and wrapper metadata
|
|
differs for container children, so unknown wrapper fields must survive
|
|
request validation and response serialization.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | object | | Yes |
|
|
| id | string | | Yes |
|
|
| position | [WorkflowGraphPosition](#workflowgraphposition) | | Yes |
|
|
| type | string | | Yes |
|
|
|
|
#### WorkflowGraphPosition
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| x | number | | Yes |
|
|
| y | number | | Yes |
|
|
|
|
#### WorkflowGraphViewport
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| x | number | | Yes |
|
|
| y | number | | Yes |
|
|
| zoom | number | | Yes |
|
|
|
|
#### WorkflowInstructionSuggestionsPayload
|
|
|
|
Payload for the workflow-generator instruction-suggestions endpoint.
|
|
|
|
Runs before the user picks a model, so the suggestions come from the
|
|
tenant's default model. The underlying generator never raises — an empty
|
|
``suggestions`` list is a valid 200 (soft-fail).
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| count | integer, <br>**Default:** 4 | Number of suggestions to return (1-6) | No |
|
|
| language | string | Optional language to write the suggestions in | No |
|
|
| mode | string, <br>**Available values:** "advanced-chat", "workflow" | Target app mode for the suggestions<br>*Enum:* `"advanced-chat"`, `"workflow"` | Yes |
|
|
|
|
#### WorkflowInstructionSuggestionsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| suggestions | [ string ] | | Yes |
|
|
|
|
#### WorkflowListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| limit | integer, <br>**Default:** 10 | | No |
|
|
| named_only | boolean | | No |
|
|
| page | integer, <br>**Default:** 1 | | No |
|
|
| user_id | string | | No |
|
|
|
|
#### WorkflowNodeJobConfig
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| declared_outputs | [ [DeclaredOutputConfig](#declaredoutputconfig) ] | | No |
|
|
| human_contacts | [ [AgentHumanContactConfig](#agenthumancontactconfig) ] | | No |
|
|
| metadata | [WorkflowNodeJobMetadata](#workflownodejobmetadata) | | No |
|
|
| mode | [WorkflowNodeJobMode](#workflownodejobmode) | | No |
|
|
| previous_node_output_refs | [ [WorkflowPreviousNodeOutputRef](#workflowpreviousnodeoutputref) ] | | No |
|
|
| schema_version | integer, <br>**Default:** 1 | | No |
|
|
| workflow_prompt | string | | No |
|
|
|
|
#### WorkflowNodeJobMetadata
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| agent_soul | object | | No |
|
|
| file_refs | [ [AgentFileRefConfig](#agentfilerefconfig) ] | | No |
|
|
|
|
#### WorkflowNodeJobMode
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| WorkflowNodeJobMode | string | | |
|
|
|
|
#### WorkflowOnlineUser
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| avatar | string | | No |
|
|
| user_id | string | | Yes |
|
|
| username | string | | Yes |
|
|
|
|
#### WorkflowOnlineUsersByApp
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_id | string | | Yes |
|
|
| users | [ [WorkflowOnlineUser](#workflowonlineuser) ] | | Yes |
|
|
|
|
#### WorkflowOnlineUsersPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| app_ids | [ string ] | App IDs | No |
|
|
|
|
#### WorkflowOnlineUsersResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [WorkflowOnlineUsersByApp](#workflowonlineusersbyapp) ] | | Yes |
|
|
|
|
#### WorkflowPaginationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| has_more | boolean | | Yes |
|
|
| items | [ [WorkflowResponse](#workflowresponse) ] | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
|
|
#### WorkflowPartial
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| created_by | string | | No |
|
|
| id | string | | Yes |
|
|
| updated_at | integer | | No |
|
|
| updated_by | string | | No |
|
|
|
|
#### WorkflowPauseDetailsResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| paused_at | string | | No |
|
|
| paused_nodes | [ [PausedNodeResponse](#pausednoderesponse) ] | | Yes |
|
|
|
|
#### WorkflowPlanNodeResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| label | string | | Yes |
|
|
| node_type | string | | Yes |
|
|
| purpose | string | | No |
|
|
|
|
#### WorkflowPlanStartInputResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| label | string | | No |
|
|
| type | string | | No |
|
|
| variable | string | | Yes |
|
|
|
|
#### WorkflowPreviousNodeOutputRef
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| key | string | | No |
|
|
| name | string | | No |
|
|
| node_id | string | | No |
|
|
| output | string | | No |
|
|
| selector | [ string<br>integer<br>number<br>boolean ] | | No |
|
|
| value_selector | [ string<br>integer<br>number<br>boolean ] | | No |
|
|
| variable | string | | No |
|
|
| variable_selector | [ string<br>integer<br>number<br>boolean ] | | No |
|
|
|
|
#### WorkflowPublishResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | Yes |
|
|
| result | string | | Yes |
|
|
|
|
#### WorkflowResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| conversation_variables | [ [WorkflowConversationVariableResponse](#workflowconversationvariableresponse) ] | | Yes |
|
|
| created_at | integer | | Yes |
|
|
| created_by | [SimpleAccountResponse](#simpleaccountresponse) | | No |
|
|
| environment_variables | [ [WorkflowEnvironmentVariableResponse](#workflowenvironmentvariableresponse) ] | | Yes |
|
|
| features | object | | Yes |
|
|
| graph | object | | Yes |
|
|
| hash | string | | Yes |
|
|
| id | string | | Yes |
|
|
| marked_comment | string | | Yes |
|
|
| marked_name | string | | Yes |
|
|
| rag_pipeline_variables | [ [PipelineVariableResponse](#pipelinevariableresponse) ] | | Yes |
|
|
| tool_published | boolean | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
| updated_by | [SimpleAccountResponse](#simpleaccountresponse) | | No |
|
|
| version | string | | Yes |
|
|
|
|
#### WorkflowRestoreResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| hash | string | | Yes |
|
|
| result | string | | Yes |
|
|
| updated_at | integer | | Yes |
|
|
|
|
#### WorkflowRunArchiveDownloadPayload
|
|
|
|
Request body for preparing one monthly workflow-run archive download.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| month | integer | | Yes |
|
|
| year | integer | | Yes |
|
|
|
|
#### WorkflowRunArchiveDownloadStatus
|
|
|
|
Lifecycle state for an asynchronous archive download request.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| WorkflowRunArchiveDownloadStatus | string | Lifecycle state for an asynchronous archive download request. | |
|
|
|
|
#### WorkflowRunArchiveDownloadTaskResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| archive_bytes | integer | | Yes |
|
|
| bundle_count | integer | | Yes |
|
|
| created_at | dateTime | | Yes |
|
|
| download_id | string | | Yes |
|
|
| error | string | | No |
|
|
| expires_at | dateTime | | Yes |
|
|
| file_name | string | | No |
|
|
| file_size_bytes | integer | | No |
|
|
| finished_at | string | | No |
|
|
| month | integer | | Yes |
|
|
| started_at | string | | No |
|
|
| status | [WorkflowRunArchiveDownloadStatus](#workflowrunarchivedownloadstatus) | | Yes |
|
|
| updated_at | dateTime | | Yes |
|
|
| year | integer | | Yes |
|
|
|
|
#### WorkflowRunArchiveListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| months | [ [WorkflowRunArchiveMonthResponse](#workflowrunarchivemonthresponse) ] | | Yes |
|
|
| summary | [WorkflowRunArchiveSummaryResponse](#workflowrunarchivesummaryresponse) | | Yes |
|
|
|
|
#### WorkflowRunArchiveMonthResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| archive_bytes | integer | | Yes |
|
|
| bundle_count | integer | | Yes |
|
|
| download_task | [WorkflowRunArchiveDownloadTaskResponse](#workflowrunarchivedownloadtaskresponse) | | No |
|
|
| latest_archived_at | dateTime | | Yes |
|
|
| month | integer | | Yes |
|
|
| row_count | integer | | Yes |
|
|
| workflow_run_count | integer | | Yes |
|
|
| year | integer | | Yes |
|
|
|
|
#### WorkflowRunArchiveSummaryResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| archive_bytes | integer | | Yes |
|
|
| archived_month_count | integer | | Yes |
|
|
| latest_archived_at | string | | No |
|
|
| workflow_run_count | integer | | Yes |
|
|
|
|
#### WorkflowRunCountQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| status | string | Workflow run status filter | No |
|
|
| time_range | string | Filter by time range (optional): e.g., 7d (7 days), 4h (4 hours), 30m (30 minutes), 30s (30 seconds). Filters by created_at field. | No |
|
|
| triggered_from | string | Filter by trigger source: debugging or app-run. Default: debugging | No |
|
|
|
|
#### WorkflowRunCountResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| failed | integer | | Yes |
|
|
| partial_succeeded | integer | | Yes |
|
|
| running | integer | | Yes |
|
|
| stopped | integer | | Yes |
|
|
| succeeded | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### WorkflowRunDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| created_by_account | [SimpleAccountResponse](#simpleaccountresponse) | | No |
|
|
| created_by_end_user | [SimpleEndUser](#simpleenduser) | | No |
|
|
| created_by_role | string | | No |
|
|
| elapsed_time | number | | No |
|
|
| error | string | | No |
|
|
| exceptions_count | integer | | No |
|
|
| finished_at | integer | | No |
|
|
| graph | | | Yes |
|
|
| id | string | | Yes |
|
|
| inputs | | | Yes |
|
|
| outputs | | | Yes |
|
|
| status | string | | No |
|
|
| total_steps | integer | | No |
|
|
| total_tokens | integer | | No |
|
|
| version | string | | No |
|
|
|
|
#### WorkflowRunExportResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| presigned_url | string | Pre-signed URL for download | No |
|
|
| presigned_url_expires_at | string | Pre-signed URL expiration time | No |
|
|
| status | string | Export status: success/failed | Yes |
|
|
|
|
#### WorkflowRunForArchivedLogResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| elapsed_time | number | | No |
|
|
| id | string | | Yes |
|
|
| status | string | | No |
|
|
| total_tokens | integer | | No |
|
|
| triggered_from | string | | No |
|
|
|
|
#### WorkflowRunForListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| created_by_account | [SimpleAccountResponse](#simpleaccountresponse) | | No |
|
|
| elapsed_time | number | | No |
|
|
| exceptions_count | integer | | No |
|
|
| finished_at | integer | | No |
|
|
| id | string | | Yes |
|
|
| retry_index | integer | | No |
|
|
| status | string | | No |
|
|
| total_steps | integer | | No |
|
|
| total_tokens | integer | | No |
|
|
| version | string | | No |
|
|
|
|
#### WorkflowRunForLogResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| elapsed_time | number | | No |
|
|
| error | string | | No |
|
|
| exceptions_count | integer | | No |
|
|
| finished_at | integer | | No |
|
|
| id | string | | Yes |
|
|
| status | string | | No |
|
|
| total_steps | integer | | No |
|
|
| total_tokens | integer | | No |
|
|
| triggered_from | string | | No |
|
|
| version | string | | No |
|
|
|
|
#### WorkflowRunListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| last_id | string | Last run ID for pagination | No |
|
|
| limit | integer, <br>**Default:** 20 | Number of items per page (1-100) | No |
|
|
| status | string | Workflow run status filter | No |
|
|
| triggered_from | string | Filter by trigger source: debugging or app-run. Default: debugging | No |
|
|
|
|
#### WorkflowRunNodeExecutionListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [WorkflowRunNodeExecutionResponse](#workflowrunnodeexecutionresponse) ] | | Yes |
|
|
|
|
#### WorkflowRunNodeExecutionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| created_by_account | [SimpleAccountResponse](#simpleaccountresponse) | | No |
|
|
| created_by_end_user | [SimpleEndUser](#simpleenduser) | | No |
|
|
| created_by_role | string | | No |
|
|
| elapsed_time | number | | No |
|
|
| error | string | | No |
|
|
| execution_metadata | | | No |
|
|
| extras | | | No |
|
|
| finished_at | integer | | No |
|
|
| id | string | | Yes |
|
|
| index | integer | | No |
|
|
| inputs | | | No |
|
|
| inputs_truncated | boolean | | No |
|
|
| node_id | string | | No |
|
|
| node_type | string | | No |
|
|
| outputs | | | No |
|
|
| outputs_truncated | boolean | | No |
|
|
| predecessor_node_id | string | | No |
|
|
| process_data | | | No |
|
|
| process_data_truncated | boolean | | No |
|
|
| retry_index | integer | | No |
|
|
| status | string | | No |
|
|
| title | string | | No |
|
|
|
|
#### WorkflowRunPaginationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [WorkflowRunForListResponse](#workflowrunforlistresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
|
|
#### WorkflowRunPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ object ] | File list for workflow system file inputs. Available when file upload is enabled for the workflow. To attach a local file, first upload it via [Upload File](/api-reference/files/upload-file) and use the returned `id` as `upload_file_id` with `transfer_method: local_file`. | No |
|
|
| inputs | object | Key-value pairs for workflow input variables. Values for file-type variables should be arrays of file objects with `type`, `transfer_method`, and either `url` or `upload_file_id`. Refer to the `user_input_form` field in the [Get App Parameters](/api-reference/applications/get-app-parameters) response to discover the variable names and types expected by your app. | Yes |
|
|
|
|
#### WorkflowRunQuery
|
|
|
|
Query parameters for workflow runs.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| last_id | string | | No |
|
|
| limit | integer, <br>**Default:** 20 | | No |
|
|
|
|
#### WorkflowRunRequest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| files | [ object ] | | No |
|
|
| inputs | object | | Yes |
|
|
|
|
#### WorkflowRunSnapshotView
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| node_outputs | [ [NodeOutputsView](#nodeoutputsview) ] | | No |
|
|
| workflow_run_id | string | | Yes |
|
|
| workflow_run_status | [WorkflowExecutionStatus](#workflowexecutionstatus) | | Yes |
|
|
|
|
#### WorkflowSensitiveWordAvoidancePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| config | object | | No |
|
|
| enabled | boolean | | No |
|
|
| type | string | | No |
|
|
|
|
#### WorkflowStatisticQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| end | string | End date and time (YYYY-MM-DD HH:MM) | No |
|
|
| start | string | Start date and time (YYYY-MM-DD HH:MM) | No |
|
|
|
|
#### WorkflowSuggestedQuestionsAfterAnswerPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| enabled | boolean | | No |
|
|
| model | object | | No |
|
|
| prompt | string | | No |
|
|
|
|
#### WorkflowTextToSpeechPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| autoPlay | string | | No |
|
|
| enabled | boolean | | No |
|
|
| language | string | | No |
|
|
| voice | string | | No |
|
|
|
|
#### WorkflowToolCreatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | Yes |
|
|
| icon | [ToolEmojiIcon](#toolemojiicon) | | Yes |
|
|
| label | string | | Yes |
|
|
| labels | [ string ] | | No |
|
|
| name | string | | Yes |
|
|
| parameters | [ [WorkflowToolParameterConfiguration](#workflowtoolparameterconfiguration) ] | | No |
|
|
| privacy_policy | string | | No |
|
|
| workflow_app_id | string | | Yes |
|
|
|
|
#### WorkflowToolDeletePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| workflow_tool_id | string | | Yes |
|
|
|
|
#### WorkflowToolDetailResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | Yes |
|
|
| icon | [ToolEmojiIcon](#toolemojiicon) | | Yes |
|
|
| label | string | | Yes |
|
|
| name | string | | Yes |
|
|
| output_schema | object | | No |
|
|
| parameters | [ [WorkflowToolParameterConfiguration](#workflowtoolparameterconfiguration) ] | | Yes |
|
|
| privacy_policy | string | | No |
|
|
| synced | boolean | | Yes |
|
|
| tool | [ToolApiEntity](#toolapientity) | | Yes |
|
|
| workflow_app_id | string | | Yes |
|
|
| workflow_tool_id | string | | Yes |
|
|
|
|
#### WorkflowToolGetQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| workflow_app_id | string | | No |
|
|
| workflow_tool_id | string | | No |
|
|
|
|
#### WorkflowToolListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| workflow_tool_id | string | | Yes |
|
|
|
|
#### WorkflowToolParameterConfiguration
|
|
|
|
Workflow tool configuration
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | The description of the parameter | Yes |
|
|
| form | [ToolParameterForm](#toolparameterform) | The form of the parameter | Yes |
|
|
| name | string | The name of the parameter | Yes |
|
|
|
|
#### WorkflowToolUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| description | string | | Yes |
|
|
| icon | [ToolEmojiIcon](#toolemojiicon) | | Yes |
|
|
| label | string | | Yes |
|
|
| labels | [ string ] | | No |
|
|
| name | string | | Yes |
|
|
| parameters | [ [WorkflowToolParameterConfiguration](#workflowtoolparameterconfiguration) ] | | No |
|
|
| privacy_policy | string | | No |
|
|
| workflow_tool_id | string | | Yes |
|
|
|
|
#### WorkflowTriggerListResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [WorkflowTriggerResponse](#workflowtriggerresponse) ] | | Yes |
|
|
|
|
#### WorkflowTriggerResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | string | | No |
|
|
| icon | string | | Yes |
|
|
| id | string | | Yes |
|
|
| node_id | string | | Yes |
|
|
| provider_name | string | | Yes |
|
|
| status | string | | Yes |
|
|
| title | string | | Yes |
|
|
| trigger_type | string | | Yes |
|
|
| updated_at | string | | No |
|
|
|
|
#### WorkflowUpdatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| marked_comment | string | | No |
|
|
| marked_name | string | | No |
|
|
|
|
#### WorkspaceAccessMatrix
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| items | [ [AccessMatrixItem](#accessmatrixitem) ] | | No |
|
|
| pagination | [Pagination](#pagination) | | No |
|
|
|
|
#### WorkspaceCustomConfigPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| remove_webapp_brand | boolean | | No |
|
|
| replace_webapp_logo | string | | No |
|
|
|
|
#### WorkspaceCustomConfigResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| remove_webapp_brand | boolean | | No |
|
|
| replace_webapp_logo | string | | No |
|
|
|
|
#### WorkspaceInfoPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| name | string | | Yes |
|
|
|
|
#### WorkspaceListItemResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| created_at | integer | | No |
|
|
| id | string | | Yes |
|
|
| name | string | | No |
|
|
| status | string | | No |
|
|
|
|
#### WorkspaceListQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| limit | integer, <br>**Default:** 20 | | No |
|
|
| page | integer, <br>**Default:** 1 | | No |
|
|
|
|
#### WorkspaceLogoUploadResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| id | string | | Yes |
|
|
|
|
#### WorkspacePaginationResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [WorkspaceListItemResponse](#workspacelistitemresponse) ] | | Yes |
|
|
| has_more | boolean | | Yes |
|
|
| limit | integer | | Yes |
|
|
| page | integer | | Yes |
|
|
| total | integer | | Yes |
|
|
|
|
#### WorkspacePermissionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| allow_member_invite | boolean | | Yes |
|
|
| allow_owner_transfer | boolean | | Yes |
|
|
| workspace_id | string | | Yes |
|
|
|
|
#### WorkspacePermissionSnapshot
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| permission_keys | [ string ] | | No |
|
|
|
|
#### WorkspaceTenantResultResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | | Yes |
|
|
| tenant | [TenantInfoResponse](#tenantinforesponse) | | Yes |
|
|
|
|
#### _AccessControlLanguageQuery
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| language | string | Localized policy label language | No |
|
|
|
|
#### _AccessPolicyList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [AccessPolicy](#accesspolicy) ] | | No |
|
|
| pagination | [Pagination](#pagination) | | No |
|
|
|
|
#### _DeleteMemberBindingsRequest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| account_ids | [ string ] | | No |
|
|
|
|
#### _MembersInRoleList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [MembersInRole](#membersinrole) ] | | No |
|
|
| pagination | [Pagination](#pagination) | | No |
|
|
|
|
#### _RBACRoleAccountList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [RBACRoleAccount](#rbacroleaccount) ] | | No |
|
|
| pagination | [Pagination](#pagination) | | No |
|
|
|
|
#### _RBACRoleList
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| data | [ [RBACRole](#rbacrole) ] | | No |
|
|
| pagination | [Pagination](#pagination) | | No |
|
|
|
|
#### _ReplaceBindingsRequest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| account_ids | [ string ] | | No |
|
|
| role_ids | [ string ] | | No |
|
|
|
|
#### _ReplaceMemberRolesRequest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| role_ids | [ string ], <br>**Default:** | | No |
|
|
|
|
#### _ResourceAccessScopeRequest
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| scope | [RBACResourceWhitelistScope](#rbacresourcewhitelistscope) | | Yes |
|
|
|
|
#### core__tools__entities__common_entities__I18nObject
|
|
|
|
Model class for i18n object.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| en_US | string | | Yes |
|
|
| ja_JP | string | | No |
|
|
| pt_BR | string | | No |
|
|
| zh_Hans | string | | No |
|
|
|
|
#### graphon__model_runtime__entities__common_entities__I18nObject
|
|
|
|
Model class for i18n object.
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| en_US | string | | Yes |
|
|
| zh_Hans | string | | No |
|
|
|
|
## FastOpenAPI Preview (OpenAPI 3.1)
|
|
|
|
### Dify API (FastOpenAPI PoC)
|
|
FastOpenAPI proof of concept for Dify API
|
|
|
|
#### Version: 1.0
|
|
|
|
---
|
|
|
|
##### [GET] /console/api/init
|
|
**Get initialization validation status.**
|
|
|
|
###### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | OK | **application/json**: [InitStatusResponse](#initstatusresponse)<br> |
|
|
|
|
##### [POST] /console/api/init
|
|
**Validate initialization password.**
|
|
|
|
###### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [InitValidatePayload](#initvalidatepayload)<br> |
|
|
|
|
###### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Created | **application/json**: [InitValidateResponse](#initvalidateresponse)<br> |
|
|
|
|
##### [GET] /console/api/ping
|
|
**Health check endpoint for connection testing.**
|
|
|
|
###### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | OK | **application/json**: [PingResponse](#pingresponse)<br> |
|
|
|
|
##### [GET] /console/api/setup
|
|
**Get system setup status.
|
|
|
|
NOTE: This endpoint is unauthenticated by design.
|
|
|
|
During first-time bootstrap there is no admin account yet, so frontend initialization must be
|
|
able to query setup progress before any login flow exists.
|
|
|
|
Only bootstrap-safe status information should be returned by this endpoint.
|
|
**
|
|
|
|
###### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | OK | **application/json**: [SetupStatusResponse](#setupstatusresponse)<br> |
|
|
|
|
##### [POST] /console/api/setup
|
|
**Initialize system setup with admin account.
|
|
|
|
NOTE: This endpoint is unauthenticated by design for first-time bootstrap.
|
|
Access is restricted by deployment mode (`SELF_HOSTED`), one-time setup guards,
|
|
and init-password validation rather than user session authentication.
|
|
**
|
|
|
|
###### Request Body
|
|
|
|
| Required | Schema |
|
|
| -------- | ------ |
|
|
| Yes | **application/json**: [SetupRequestPayload](#setuprequestpayload)<br> |
|
|
|
|
###### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 201 | Created | **application/json**: [SetupResponse](#setupresponse)<br> |
|
|
|
|
##### [GET] /console/api/version
|
|
**Check for application version updates.**
|
|
|
|
###### Parameters
|
|
|
|
| Name | Located in | Description | Required | Schema |
|
|
| ---- | ---------- | ----------- | -------- | ------ |
|
|
| current_version | query | | Yes | string |
|
|
|
|
###### Responses
|
|
|
|
| Code | Description | Schema |
|
|
| ---- | ----------- | ------ |
|
|
| 200 | OK | **application/json**: [VersionResponse](#versionresponse)<br> |
|
|
|
|
---
|
|
##### Schemas
|
|
|
|
###### ErrorSchema
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| error | { **"details"**: string, **"message"**: string, **"status"**: integer, **"type"**: string } | | Yes |
|
|
|
|
###### InitStatusResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| status | string, <br>**Available values:** "finished", "not_started" | Initialization status<br>*Enum:* `"finished"`, `"not_started"` | Yes |
|
|
|
|
###### InitValidatePayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| password | string | Initialization password | Yes |
|
|
|
|
###### InitValidateResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | Operation result | Yes |
|
|
|
|
###### PingResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | Health check result | Yes |
|
|
|
|
###### SetupRequestPayload
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| email | string | Admin email address | Yes |
|
|
| language | string | Admin language | No |
|
|
| name | string | Admin name (max 30 characters) | Yes |
|
|
| password | string | Admin password | Yes |
|
|
|
|
###### SetupResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| result | string | Setup result | Yes |
|
|
|
|
###### SetupStatusResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| setup_at | string | Setup completion time (ISO format) | No |
|
|
| step | string, <br>**Available values:** "finished", "not_started" | Setup step status<br>*Enum:* `"finished"`, `"not_started"` | Yes |
|
|
|
|
###### VersionFeatures
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| can_replace_logo | boolean | Whether logo replacement is supported | Yes |
|
|
| model_load_balancing_enabled | boolean | Whether model load balancing is enabled | Yes |
|
|
|
|
###### VersionResponse
|
|
|
|
| Name | Type | Description | Required |
|
|
| ---- | ---- | ----------- | -------- |
|
|
| can_auto_update | boolean | Whether auto-update is supported | Yes |
|
|
| features | [VersionFeatures](#versionfeatures) | Feature flags and capabilities | Yes |
|
|
| release_date | string | Release date of latest version | Yes |
|
|
| release_notes | string | Release notes for latest version | Yes |
|
|
| version | string | Latest version number | Yes |
|